KEGG   Streptococcus pyogenes MGAS10750 (serotype M4): MGAS10750_Spy1613Help
Entry
MGAS10750_Spy1613 CDS       T00356                                 

Gene name
ssb2
Definition
(GenBank) Single strand binding protein
  KO
K03111  single-strand DNA-binding protein
Organism
spi  Streptococcus pyogenes MGAS10750 (serotype M4)
Pathway
spi03030  DNA replication
spi03430  Mismatch repair
spi03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:spi00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    MGAS10750_Spy1613 (ssb2)
   03430 Mismatch repair
    MGAS10750_Spy1613 (ssb2)
   03440 Homologous recombination
    MGAS10750_Spy1613 (ssb2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:spi03032]
    MGAS10750_Spy1613 (ssb2)
   03400 DNA repair and recombination proteins [BR:spi03400]
    MGAS10750_Spy1613 (ssb2)
   03029 Mitochondrial biogenesis [BR:spi03029]
    MGAS10750_Spy1613 (ssb2)
DNA replication proteins [BR:spi03032]
 Prokaryotic type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    MGAS10750_Spy1613 (ssb2)
DNA repair and recombination proteins [BR:spi03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Other MMR factors
     MGAS10750_Spy1613 (ssb2)
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    MGAS10750_Spy1613 (ssb2)
Mitochondrial biogenesis [BR:spi03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA replication factors
   Other Mitochondrial DNA replication factors
    MGAS10750_Spy1613 (ssb2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SSB tRNA_anti-codon Cyclin_C_2 Phage_SSB
Motif
Other DBs
NCBI-ProteinID: ABF38563
UniProt: Q1J523
Position
complement(1551139..1551630)
Genome map
AA seq 163 aa AA seqDB search
MINNVVLVGRMTKDAELRYTPSQVAVATFTLAVNRTFKSQNGEREADFINCVIWRQPAEN
LANWAKKGALIGVTGRIQTRNYENQQGQRVYVTEVVADNFQMLESRATREGGSTGSFNGG
FNNNTSSSNSYSAPAQQTPNFGRDDSPFGNSNPMDISDDDLPF
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgattaataatgtagtactagttggtcgtatgaccaaggatgcagaacttcgttacaca
ccaagtcaggtagctgtggctaccttcacacttgctgttaaccgtacctttaaaagccaa
aatggtgaacgcgaggcagatttcattaactgtgtgatctggcgtcaaccggctgaaaat
ttagcgaactgggctaaaaaaggtgccttgatcggagttacgggtcgtattcagacacgt
aactacgaaaaccaacaaggacaacgtgtctatgtaacagaagttgttgcagataatttc
caaatgttggaaagtcgtgctacacgtgaaggtggctcaactggctcatttaatggtggt
tttaacaataacacttcatcatcaaacagttactcagcgcctgcacaacaaacgcctaac
tttggaagagatgatagcccatttgggaactcaaacccgatggatatctcagatgacgat
cttccattctag

DBGET integrated database retrieval system