KEGG   Streptococcus pyogenes MGAS10750 (serotype M4): MGAS10750_Spy1623
Entry
MGAS10750_Spy1623 CDS       T00356                                 

Definition
(GenBank) Ribonuclease HIII
  KO
K03471  ribonuclease HIII [EC:3.1.26.4]
Organism
spi  Streptococcus pyogenes MGAS10750 (serotype M4)
Pathway
spi03030  DNA replication
Brite
KEGG Orthology (KO) [BR:spi00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    MGAS10750_Spy1623
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:spi03032]
    MGAS10750_Spy1623
Enzymes [BR:spi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.4  ribonuclease H
     MGAS10750_Spy1623
DNA replication proteins [BR:spi03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    RNase H
     MGAS10750_Spy1623
SSDB
Motif
Pfam: RNase_HII DUF3378 RnlA_toxin TBP
Other DBs
NCBI-ProteinID: ABF38573
UniProt: Q1J513
Position
1558947..1559849
AA seq 300 aa
MNTLVLKIDAILSKHLKKQLAPYTINSQNTYVAFAAKKNGVTVLLYKSGKLVLQGNGANA
LAQELNLPVAKTVFEASNNSQDIPIIGSDEVGNGSYFGGIAVVASFVDPKDHSFLKKLGV
DDSKKLSDKTIQQIAPLLEKQIPHQSLLLSPKKYNELVGKSKPYNAISIKVALHNQAIFL
LLQKGIQPKQIVIDAFTSQSNYEKHLKKEKSHFPNPLTFQEKAESHYLAVAVSSIIARNL
FLDNLDQLGQDLGYQLPSGAGSASDKVASQLLAAYGMSSLEYSAKLHFANTHKAQALLTK
NT seq 903 nt   +upstreamnt  +downstreamnt
atgaataccttagttttgaaaatagatgctatactgagtaaacatttaaaaaaacagcta
gccccctacaccatcaatagccaaaatacctatgtagcctttgctgctaaaaaaaatggg
gttactgttttgctgtacaaatccggaaaattagttctccagggaaacggtgcaaatgct
ttagctcaagagcttaatcttccagtagctaagacagtttttgaagcaagcaacaatagc
caagatatacctataatcggcagtgatgaggtgggtaatggctcttattttggtgggatt
gctgttgtggcaagttttgtcgatcctaaagatcattccttcctgaaaaagcttggggtt
gatgattctaaaaaattatcggataaaaccattcaacagattgcgcctctgttagagaaa
caaatacctcatcaatcacttctcctatcacctaaaaaatataacgaattggttggtaaa
agtaaaccatataatgccatttctatcaaagttgctcttcataaccaagctatttttttg
ttgttacaaaaaggcattcaacctaaacaaattgttattgatgctttcactagccaatca
aattatgaaaagcatctaaaaaaggaaaaaagccatttcccaaatcctctaacctttcaa
gaaaaggcagaaagtcactatttggctgtggctgttagctctatcattgctagaaatcta
tttttagacaatctcgatcaattaggtcaagatttaggttaccaactcccaagcggtgct
ggttcagcttcagataaagttgctagccaactcttagccgcttatggtatgtctagctta
gaatatagtgctaaacttcacttcgccaacactcacaaagcgcaagcgcttctcactaaa
taa

DBGET integrated database retrieval system