KEGG   Streptococcus pyogenes MGAS10750 (serotype M4): MGAS10750_Spy1649Help
Entry
MGAS10750_Spy1649 CDS       T00356                                 

Definition
(GenBank) O-sialoglycoprotein endopeptidase
  KO
K01409  N6-L-threonylcarbamoyladenine synthase [EC:2.3.1.234]
Organism
spi  Streptococcus pyogenes MGAS10750 (serotype M4)
Brite
KEGG Orthology (KO) [BR:spi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:spi03016]
    MGAS10750_Spy1649
Enzymes [BR:spi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.234  N6-L-threonylcarbamoyladenine synthase
     MGAS10750_Spy1649
Transfer RNA biogenesis [BR:spi03016]
 Eukaryotic type
  tRNA modification factors
   KEOPS/EKC complex
    MGAS10750_Spy1649
 Prokaryotic type
    MGAS10750_Spy1649
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M22 Carbam_trans_N baeRF_family2 S4
Motif
Other DBs
NCBI-ProteinID: ABF38599
UniProt: Q1J4Y7
Position
complement(1585139..1586167)
Genome map
AA seq 342 aa AA seqDB search
MTDRYILAVESSCDETSVAILKNESTLLSNVIASQVESHKRFGGVVPEVASRHHVEVITT
CFEDALQEAGISASDLSAVAVTYGPGLVGALLVGLAAAKAFAWANHLPLIPVNHMAGHLM
AAREQKPLVYPLIALLVSGGHTELVYVPEPGDYHIIGETRDDAVGEAYDKVGRVMGLTYP
AGREIDQLAHKGQDTYHFPRAMITEDHLEFSFSGLKSAFINLHHNAKQKGNELILEDLCA
SFQAAVLDILLAKTKKALSRYPAKMLVVAGGVAANQGLRDRLAQEITHIEVVIPKLRLCG
DNAGMIALAAAIEYDKQHFANMSLNAKPSLAFDQFPDSFVIN
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgacagataggtatattttagcagttgagagttcttgtgatgagaccagtgtagcgatt
ttaaaaaacgaaagtaccctcttaagtaatgtcattgcaagtcaggttgagagccacaaa
cgctttggtggtgtggtgccagaagtagctagtagacaccatgtcgaagtgattacgact
tgctttgaggatgctttgcaagaagctggcatcagtgcttcagatttatcagcagttgcg
gtaacttatggccctggacttgttggagccttgttagttggattagcagctgcgaaggct
tttgcttgggcaaatcatttacctttgattccggttaatcatatggcaggtcacttaatg
gcagcgcgtgaacaaaagcctttagtttatcctttaatagcactattggtttcaggagga
cacacagaattggtttatgtcccagagccaggggattatcatattattggcgagacgcgt
gacgacgctgttggtgaggcttatgataaagttgggcgtgtgatgggcttaacctatccg
gcaggacgtgaaattgatcagttggctcataaaggtcaagatacttatcatttccctcgt
gctatgataacagaagaccacttagaattttctttttcaggactcaaatccgcttttatc
aatcttcatcataatgctaagcaaaaaggcaatgaactgattctagaagatttgtgtgca
tcttttcaagcagctgttctagatattttattggccaaaacaaaaaaagctctgagcaga
taccctgcaaagatgcttgtagtggctggtggtgtagcggcaaatcaaggattacgagat
agattagcacaagaaattacacatatagaagttgtgattcctaaactaagactctgtgga
gataacgcgggtatgattgctttagcagcagctattgagtatgacaaacagcattttgct
aatatgagcctaaacgcgaagcctagtttagcttttgaccagtttccagacagttttgta
ataaactag

DBGET integrated database retrieval system