KEGG   Streptococcus pyogenes MGAS10750 (serotype M4): MGAS10750_Spy1779
Entry
MGAS10750_Spy1779 CDS       T00356                                 

Definition
(GenBank) D-tyrosyl-tRNA(Tyr) deacylase
  KO
K07560  D-aminoacyl-tRNA deacylase [EC:3.1.1.96]
Organism
spi  Streptococcus pyogenes MGAS10750 (serotype M4)
Brite
KEGG Orthology (KO) [BR:spi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:spi03016]
    MGAS10750_Spy1779
Enzymes [BR:spi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.96  D-aminoacyl-tRNA deacylase
     MGAS10750_Spy1779
Transfer RNA biogenesis [BR:spi03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Trans-editing factors
    MGAS10750_Spy1779
 Prokaryotic type
    MGAS10750_Spy1779
SSDB
Motif
Pfam: Tyr_Deacylase
Other DBs
NCBI-ProteinID: ABF38729
UniProt: Q1J4K7
Position
complement(1731224..1731667)
AA seq 147 aa
MKLVLQRVKEASVSIDGKIAGAINQGLLLLVGVGPDDNAEDLAYAVRKIVNMRIFSDADG
KMNQSIQDIKGSILSVSQFTLYADTKKGNRPAFTGAAKPDLASQLYDSFNEQLAEFVPVE
RGVFGADMQVSLINDGPVTIILDTKCH
NT seq 444 nt   +upstreamnt  +downstreamnt
atgaaacttgtcttgcaacgggtcaaagaggcctctgtttctattgatgggaaaattgct
ggcgctattaaccaagggttgttgttgttagtaggtgtgggaccagatgataatgcagaa
gatttggcttacgctgtgcgaaaaatagtcaacatgcgcattttttcagatgctgatggc
aagatgaatcagtctatccaagacatcaagggcagtatcttatctgtgtcgcaatttacc
ctttatgctgacaccaaaaagggaaaccgtcctgcctttactggtgctgctaagccagat
ttggctagccagttgtatgatagctttaatgaacaattggcagagtttgtgccagttgag
cgtggcgtttttggggcagatatgcaggttagtctcatcaatgatggaccagttacgatt
attttagacacgaaatgtcactag

DBGET integrated database retrieval system