KEGG   Streptococcus pyogenes MGAS10750 (serotype M4): MGAS10750_Spy1925Help
Entry
MGAS10750_Spy1925 CDS       T00356                                 

Gene name
argS
Definition
(GenBank) Arginyl-tRNA synthetase
  KO
K01887  arginyl-tRNA synthetase [EC:6.1.1.19]
Organism
spi  Streptococcus pyogenes MGAS10750 (serotype M4)
Pathway
spi00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:spi00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    MGAS10750_Spy1925 (argS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:spi01007]
    MGAS10750_Spy1925 (argS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:spi03016]
    MGAS10750_Spy1925 (argS)
   03029 Mitochondrial biogenesis [BR:spi03029]
    MGAS10750_Spy1925 (argS)
Enzymes [BR:spi01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.19  arginine---tRNA ligase
     MGAS10750_Spy1925 (argS)
Amino acid related enzymes [BR:spi01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   MGAS10750_Spy1925 (argS)
Transfer RNA biogenesis [BR:spi03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    MGAS10750_Spy1925 (argS)
 Prokaryotic type
   Other AARSs
    MGAS10750_Spy1925 (argS)
Mitochondrial biogenesis [BR:spi03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    MGAS10750_Spy1925 (argS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1d DALR_1 Arg_tRNA_synt_N AvrM-A
Motif
Other DBs
NCBI-ProteinID: ABF38875
UniProt: Q1J486
Position
1880385..1882076
Genome map
AA seq 563 aa AA seqDB search
MDTKTLIASEIAKVVPELEQDAIFNLLETPKNSDMGDLAFPAFSLAKVLRKAPQMIASEL
AEQIDESQFEKVVAVGPYINFFLDKAKISSQVLEQVITAGSDYAQQDEGQGRNVAIDMSS
PNIAKPFSIGHLRSTVIGDSLAHIFAKMGYQPVKINHLGDWGKQFGMLIVAYKKWGDEAA
VQAHPIDELLKLYVRINAEAETDPTVDEEAREWFRKLEDGDKEATELWQWFRDESLLEFN
RLYDQLHVTFDSYNGEAFYNDKMDEVLELLEAKNLLVESKGAQVVNLEKYGIEHPALIKK
SDGATLYITRDLAAALYRKRTYDFAKSVYVVGNEQAAHFKQLKAVLQEMGYDWSDDMTHV
AFGLVTKGGAKLSTRKGNVILLEPTVAEAINRAASQIEAKNPNLADKEAVAHAVGVGAIK
FYDLKTDRMNGYDFDLETMVSFEGETGPYVQYAHARIQSILRKADFTPSATTTYSLADAE
SWEIIKLIQDFPRIIKRTSDNFEPSIMAKFAINLAQSFNKYYAHTRILDDNSERDNRLAL
CYATATVLKEALRLLGVDAPNEM
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atggatactaaaactctaatcgcaagtgaaatagctaaagttgttccagaattagaacaa
gatgctatttttaacttgcttgaaaccccaaaaaattctgatatgggagaccttgccttt
ccagcttttagcttagcaaaagtccttcgcaaagcccctcaaatgattgctagcgagtta
gctgaacagattgatgagagccaatttgaaaaagtcgtagctgtcggcccttacatcaat
tttttccttgataaagctaagatttcctcacaggtccttgaacaagtgattacagcaggt
tcagactatgctcagcaagacgaaggtcaagggcgaaatgttgctattgatatgtcaagc
ccaaacattgctaaaccattttcaatcggtcaccttcgctcaacagttattggtgatagt
ctcgctcacatttttgccaaaatgggttatcaacctgtaaaaatcaatcaccttggtgac
tggggtaaacaatttggtatgctcattgttgcctataaaaaatggggagacgaagctgct
gttcaggcacatcctattgatgaactcttaaaactttacgttcgtatcaatgctgaagct
gaaactgatccaaccgtcgatgaagaagctcgtgaatggttccgtaaattggaagatggc
gacaaagaagctaccgaattatggcaatggttccgtgatgagagtttgcttgagtttaac
cgtctttatgaccaattacatgtcaccttcgatagttacaacggtgaggccttctataat
gacaaaatggatgaggttcttgagctattagaagcgaaaaaccttcttgtagaatccaaa
ggtgcccaagttgttaaccttgaaaaatacggcattgaacaccctgccttgatcaaaaaa
tcagatggcgctactctttacattacccgtgacctagctgccgcactttaccgtaaacgc
acttatgactttgctaaatccgtttatgttgttggtaatgagcaagctgctcacttcaaa
cagttaaaagcagtgctacaagaaatgggttacgattggtcagatgatatgacacacgtt
gcttttggacttgtcacaaaaggcggtgctaaattatcaacacgtaaaggtaatgttatt
cttcttgaacctacggttgctgaagccattaaccgcgctgcttctcaaattgaagcgaaa
aatccaaatcttgctgataaagaagctgttgcacacgctgttggtgtcggtgccatcaag
ttttacgatctcaaaacagatcgtatgaatgggtatgactttgaccttgaaaccatggtt
tcctttgaaggagaaactggaccttatgttcaatacgctcacgctcgtatccaatctatt
ctacgtaaagctgactttacgccatctgcaaccaccacttacagtttagctgatgctgaa
agctgggaaattatcaaacttatccaagatttcccacgcattatcaagcgaacatcagat
aactttgagccttctattatggctaaatttgctattaacttagcccaaagctttaacaaa
tattatgctcacactcgcattcttgacgacaactcagaacgtgataaccgcttagctctc
tgctatgcaactgctactgttcttaaagaagcgcttcgcttactcggtgttgacgcacca
aatgaaatgtaa

DBGET integrated database retrieval system