KEGG   Spirosoma sp. KCTC 42546: EXU85_24750Help
Entry
EXU85_24750       CDS       T06164                                 

Gene name
nagA
Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
spik  Spirosoma sp. KCTC 42546
Pathway
spik00520  Amino sugar and nucleotide sugar metabolism
spik01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spik00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    EXU85_24750 (nagA)
Enzymes [BR:spik01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     EXU85_24750 (nagA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: QDK83836
UniProt: A0A515AAG4
Position
6003797..6004984
Genome map
AA seq 395 aa AA seqDB search
MRQKIVNGTVLTPFRTIRNGTVVIDNGQIMGIHEGAVDVPDAIEIDAQGQFVAPGFIDIH
VHGGGGFDFMDSTKEAFLKIAELHARYGTTALVPTTLTAEKEDLLQTLDVYEQANRSNTQ
GASFLGMHLEGPYFALSQRGAQDPRYIRNPDPDEYEEILSHSSSIVRWSAAPELEGAIPF
GQRLRQKGILVAIAHTDALYDDVLMAYENGYSLVTHLYSAMSGVTRRNAFRYAGVIESAF
LLDLDVEIIGDGIHLPPPLLKLVYKIKGADRTALITDAMRAAGMPEGESTLGSLKNGLKV
IVEDGVAKLPDRTAFAGSVATMNRLVRNMVQLADVPLLEAVRMASTTPARIMGVDHRKGS
LAKGKDADIVLFDQDFTVGMTMVQGKIIYMTEDLT
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgcggcaaaaaatagtaaacggcaccgtgttgacgcccttccgaacgatcaggaatgga
acagtagtcattgacaacggtcagattatgggtatccatgagggcgcagtcgatgttccc
gacgctatcgaaatagatgcacaaggccagtttgttgcccccggtttcatcgatattcat
gtacacggtggcggaggtttcgactttatggatagtaccaaagaagcgtttctaaaaatt
gccgaactgcacgctcgctacggcactacggcgctggttcccactaccctaacagcggag
aaagaagaccttctgcaaaccctggacgtgtacgaacaggcaaaccggagcaacacgcaa
ggagcttcgtttctggggatgcatctggaagggccttattttgcgcttagtcagcgggga
gctcaggaccctcgctacatccgaaaccccgatccagatgagtacgaagaaattctgagt
cactcctcctcaattgtgcgctggagtgcggccccggaactggaaggagcgattccgttc
gggcaacgacttcggcagaaaggaattctggtggctattgcccataccgatgcgctttat
gatgatgtgcttatggcttacgaaaacggctactcgctggtaacccacttgtattcggcc
atgtcgggagtaacacgccggaatgcgtttcggtatgcgggtgtgattgaaagcgctttc
ttactggatctggatgttgaaatcattggcgatggcatccatttgccgcccccactgctc
aaactggtctataaaatcaagggagccgaccgaactgcattgatcaccgatgccatgcga
gcggctggcatgcccgaaggcgaaagcaccttaggctcactaaaaaacggactgaaggtc
attgtggaagatggggtggccaaactacccgaccgaaccgcctttgccggtagcgtggcc
accatgaatcgccttgtccgaaatatggtgcagctagccgatgtccccttactggaagcg
gttcgaatggccagcacaacgcccgcccgcatcatgggtgtcgatcaccgaaaaggatcg
ctcgccaagggtaaagatgccgatatcgtgctcttcgatcaggattttacggttggcatg
accatggtgcagggcaaaattatttacatgaccgaagacttgacatag

DBGET integrated database retrieval system