KEGG   Spirosoma pollinicola: CWM47_02015Help
Entry
CWM47_02015       CDS       T05236                                 

Definition
(GenBank) aldehyde dehydrogenase (NADP(+))
  KO
K13877  2,5-dioxopentanoate dehydrogenase [EC:1.2.1.26]
Organism
spir  Spirosoma pollinicola
Pathway
spir00040  Pentose and glucuronate interconversions
spir00053  Ascorbate and aldarate metabolism
spir01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spir00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CWM47_02015
   00053 Ascorbate and aldarate metabolism
    CWM47_02015
Enzymes [BR:spir01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.26  2,5-dioxovalerate dehydrogenase
     CWM47_02015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AUD00701
UniProt: A0A2K8YSV0
Position
497523..499133
Genome map
AA seq 536 aa AA seqDB search
MSTTQQSFNVSFIGNEPAPGDGNLFRAFAPARHENLADEFANVSPEQADQAVTKAAEAFP
IYIKLMPAQRADFLDAIASELEALGDELIERAVLESGLPTGRISGERGRTTGQLRMFANL
LREGSWVDARINPAMPDRQPLPRTDLRRMLVPIGPVVVFGASNFPLAFSVAGGDTASALA
AGCPVVVKAHPSHPGTSSLVGQAIVVAAQKMGMPDGVFSLLHADNEVAQQLVAHPLVKAV
GFTGSRAGGLALLRVAQGRPEPIPVYAEMSAVNPVVVLPGAISQDSGPNSATTVAAGLAA
SVILGVGQFCTNPGLVFLLDSPNTASFLETVAEKIKASSPATMLNAGICSAYQKGVQQNR
IVPGVHVLAEADVDGESSQTQGRPIVLSTTAPIFLSSEFLSEEVFGPSSLIVVCATETEL
EECLRSLEGQLTATIYATPTELTHADIDWISLLQAKAGRVLFGGFPTGVEVSEAMTHGGP
FPATSDSRSTSVGTGAILRFVRPVTFQSFPDELLPSALQDANPLDIWRNVDGKMMK
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaccacgcaacaatccttcaacgtcagttttattggcaatgagcccgctccgggc
gatggcaacctatttcgcgcgtttgcgcccgcccgtcacgagaaccttgccgacgagttt
gcgaacgtttctcccgaacaagcggatcaggccgttaccaaagctgccgaagcgttcccc
atttacatcaaacttatgcctgcccaacgggctgattttttagatgccattgcctccgag
ctggaagcattgggcgacgaactcatcgaacgggcagttcttgaaagtggtctgccaaca
ggccgtatttcgggcgaacggggtcgcacaacagggcagttgcgtatgtttgctaacctg
ctccgcgagggttcgtgggtcgacgcccgtattaatccggccatgcccgaccgccagcca
ttaccccgcaccgatttgcgccggatgctggtgccaattggccctgtagtagtctttggg
gccagtaacttcccgcttgccttttcggtagcgggtggcgatacggcttcagcgttggcg
gctggttgtccggttgtagtgaaggctcacccatcgcatcccggaacgtcatcactggtt
ggtcaggcaattgtggtagctgcccagaagatgggaatgcccgatggcgttttttcgctc
cttcacgccgataatgaagttgcccagcagttagttgcgcatccattggtgaaagccgtt
ggctttaccggttcacgggctggcgggctggcgttgcttcgcgtagcccagggacgaccg
gagcctattccggtttatgccgaaatgagtgccgttaatccagttgttgtgctgccgggc
gctatcagtcaggatagtggtcccaattcggccacgactgttgcggccggattagctgct
tcggtaatcctgggtgtgggtcaattctgcaccaatccgggcttagtatttctgctcgat
tcgccgaatacagctagttttctggaaacagttgccgagaaaatcaaggcgtcgtcaccg
gcaacgatgctgaatgcaggcatttgcagtgcctatcaaaaaggcgttcaacaaaatagg
attgttcccggcgttcatgtgctggcggaagccgacgttgatggcgaaagcagccagacg
cagggacgacccatcgttttaagcactacagctcctatatttctaagcagcgaattcctg
agtgaagaagtctttggcccatcttcactaatcgttgtttgtgcgacagaaacggaattg
gaagaatgtttacgttcgctggaaggtcaactcacggcaacgatttacgctactccgacc
gagttgacacatgcagacatcgactggatttcgcttcttcaggcaaaggccgggcgagta
ctgtttggcgggtttcctacgggcgtagaagtatctgaagcaatgactcacggcggccca
ttcccggctaccagcgatagccggtcaacatccgttggtacaggggctattttgcggttt
gttcggccagttacgttccaaagcttccccgacgagttattaccatccgcattacaggat
gctaatccgctggatatctggcgaaatgtggatggaaaaatgatgaagtag

DBGET integrated database retrieval system