KEGG   Spirosoma pollinicola: CWM47_13275Help
Entry
CWM47_13275       CDS       T05236                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
spir  Spirosoma pollinicola
Brite
KEGG Orthology (KO) [BR:spir00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    CWM47_13275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: AUD02723
UniProt: A0A2K8YYL0
Position
complement(3178423..3178809)
Genome map
AA seq 128 aa AA seqDB search
MVSSVTEGVKVSVKTEYQADYSSPLQAHYVFTYRITIENASDYTIQLLRRHWLIFDSNGT
VREVEGEGVVGLQPVLEPGEVHEYVSGCNLRSSIGKMAGTYLVERIIDGKQLRVSIPEFT
MVVPYKLN
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atggtttcgtcagtcacagaaggcgtaaaagttagcgtaaagacagagtatcaggctgat
tactccagtccgctccaggcgcattacgtgtttacttaccggattaccatcgaaaacgcc
agcgactatactattcagttgctccggcgtcattggttgatttttgattctaacggcact
gttcgcgaagttgaaggggaaggtgtggttggtttacaacccgttttggagcccggcgaa
gtccacgaatatgtatcgggctgcaatctgcgctcaagcattggcaaaatggccggtacg
taccttgttgaacgcattatcgatggcaagcaacttcgggtgagcattcccgaatttacg
atggttgtgccgtataaactgaactga

DBGET integrated database retrieval system