KEGG   Spirosoma pollinicola: CWM47_23440Help
Entry
CWM47_23440       CDS       T05236                                 

Gene name
phhA
Definition
(GenBank) phenylalanine 4-monooxygenase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
spir  Spirosoma pollinicola
Pathway
spir00360  Phenylalanine metabolism
spir00400  Phenylalanine, tyrosine and tryptophan biosynthesis
spir00790  Folate biosynthesis
spir01100  Metabolic pathways
spir01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:spir00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    CWM47_23440 (phhA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CWM47_23440 (phhA)
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CWM47_23440 (phhA)
Enzymes [BR:spir01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     CWM47_23440 (phhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-ProteinID: AUD07444
UniProt: A0A2K8ZC76
Position
5557938..5558663
Genome map
AA seq 241 aa AA seqDB search
MMQTYTNYTPDDQAVWRLLFERQIAQLPGKASQAYLNGISATGFRADRIPDFERDLNLRL
QNLTGWRVQDVEGLIPNRDFFELMANRNFPATTWLRRHDQLDYLPEPDMFHDTFGHVPML
SNQAFCDFLASLSQIALHHIDSEEAIAMISRLYWYTVEFGLIQEGDQLRIYGGGILSSVG
ETTYSLLSDKPKRIPYDVETLLKTPYIIDHFQEQYFVIESFDQLYQSVQQIETTLEGLLV
S
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atcatgcagacatacaccaactatacccccgacgatcaggccgtttggcggttgctgttc
gaacggcaaatagcgcagctgcccggaaaagccagtcaggcttacctgaatggtatttcg
gcaacgggcttccgtgccgaccgtattcctgatttcgaacgggatctgaatctacggtta
cagaacctaacgggctggcgagtgcaggacgtagaggggctaattccgaatcgtgatttt
tttgaactgatggcgaatcgaaactttccggccactacctggctgcgtcggcacgaccag
ttggattatttgccggagccggatatgtttcatgacacctttgggcatgtgcctatgctg
tcgaatcaggctttttgcgattttctggcgtcgctgagtcagattgcgctgcatcatatc
gacagtgaagaagccattgctatgatttcgcggctgtactggtacaccgtcgagtttggc
ttgattcaggaaggagatcaacttcggatctatggcgggggtattttatcgtccgttggt
gaaacgacttacagcctgctcagcgacaagccgaaacgcattccgtatgacgttgagacg
ttgcttaaaacgccatacatcatcgaccattttcaggaacaatacttcgtgattgagtcc
ttcgaccagctttatcaatccgttcaacagatagagacaacgctggaaggcttgttagta
agctag

DBGET integrated database retrieval system