KEGG   Spirosoma pollinicola: CWM47_26145Help
Entry
CWM47_26145       CDS       T05236                                 

Definition
(GenBank) anion permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
spir  Spirosoma pollinicola
Brite
KEGG Orthology (KO) [BR:spir00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    CWM47_26145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AUD05022
UniProt: A0A2K8Z568
Position
6232631..6234052
Genome map
AA seq 473 aa AA seqDB search
MFGLETDVFILLFISLFAACAFEFVNGFHDTANAVATVIYTNSLKPTYAVVWSGICNFTG
VLLGGIGVAMGIVNLLPVELLVDQNVYHSVAMVLALLLSAIIWNLGTWYFGLPSSSSHTL
IGSILGVGLAFATMPENKTGAAVNWDKAIETGYALLLSPLLGFSLAIVLMFILRRSVPEE
AKDQLFKEPKKNTEPPTWVRAILITTCSLVSFFHGSNDGQKGVGLIMLILIGIVPYHFAV
KSDLDPRLMQTNIAAIQQTMGVLDTTHLSSINRERVVQTNKELSQLKALVNGPLIDGKIP
NEKRLEVRSDLLLINSNIKKITADEGSNLSSSQLAVLTKNLGEEGGLRRFTDYAPLWVIL
MIALSLGLGTMIGWRRIVVTVGEKIGKQHLTYAQGASAELVAAMMIGMASWLKLPVSTTH
VLSSGIAGSMVANKGVKNLQAGTVKNIALAWILTLPVSVLLSFTLYIFFRWVL
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgtttggcttagaaacggatgtttttatcctcctatttatcagcctgttcgctgcctgt
gcctttgagtttgttaatggttttcacgatacagccaacgccgttgccaccgttatttac
acgaattcgctaaaacctacctacgcggttgtgtggtcggggatatgcaattttaccggc
gttctgcttggcggtatcggggttgcaatgggtattgtaaatctcctgcctgttgagttg
ctggtcgatcagaatgtctatcacagcgtagctatggtgcttgctcttctcctgagcgcc
attatctggaatctgggaacttggtactttggtctccccagttcaagttcgcacacactt
attggctcgattctgggtgttggcctggcatttgccaccatgcccgaaaacaaaaccggc
gctgctgtcaactgggacaaagcgatcgaaacgggttacgccttattactctcgcccttg
ctgggtttcagtttggctattgtattgatgtttattctacgccggtctgtacccgaagaa
gcgaaagatcagctttttaaagaaccaaaaaagaatactgagcctcctacctgggttcga
gctatattgatcactacctgttcgctggtgagtttctttcatggcagtaatgacggtcag
aaaggggtagggctaattatgttgattctgattggcattgtcccctatcatttcgcggtt
aaatctgatcttgaccctcgcctgatgcagacaaatattgctgctattcagcaaacgatg
ggcgtattggacacgactcatctttcatcaataaaccgggagcgtgtcgttcaaactaat
aaagagctttctcagttaaaggccctggtgaatgggccacttatagatggcaaaattcca
aacgaaaaacgcctggaagtacggagtgatctattgctgatcaacagtaatatcaaaaag
attacggctgatgaagggtcgaatttaagttcaagtcaactggctgtactaacgaaaaac
ctgggcgaagaaggcggtctgcgtcggtttaccgactatgcgccactctgggtaattctg
atgattgcgctatcgctgggccttggtacgatgattggctggcgccggattgtggtaacg
gtaggcgaaaagattggtaagcaacacttaacctacgcacagggggcctcggcagagcta
gtcgcggccatgatgatcgggatggcatcctggctgaaattgcctgttagtacaacacac
gttctttcgtcgggtattgccggtagtatggtggccaacaaaggggtgaaaaacttacag
gctggaaccgtaaaaaatattgctttggcctggatattaaccttaccagtttcggtatta
ctctcctttacgctctatattttctttcgttgggtattgtag

DBGET integrated database retrieval system