KEGG   Stylophora pistillata: 111322734Help
Entry
111322734         CDS       T05774                                 

Definition
(RefSeq) cytosolic purine 5'-nucleotidase-like isoform X1
  KO
K01081  5'-nucleotidase [EC:3.1.3.5]
Organism
spis  Stylophora pistillata
Pathway
spis00230  Purine metabolism
spis00240  Pyrimidine metabolism
spis00760  Nicotinate and nicotinamide metabolism
spis01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spis00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    111322734
   00240 Pyrimidine metabolism
    111322734
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    111322734
Enzymes [BR:spis01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     111322734
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 5_nucleotid
Motif
Other DBs
NCBI-GeneID: 111322734
NCBI-ProteinID: XP_022781632
Position
Unknown
AA seq 605 aa AA seqDB search
MDTEKKLTSNEVEYLMVPKEGWVKSTPKDPLELKMPYPSHPFDQNSIGMDTPDGSKAFKR
DTANRVFVNRSLSLDKIKFFGFDMDYTLAVYKSPVYEKKAFRLICERLASIGYPKDVLNF
EYDESFPARGLFFDCELGNLLKVDTYGNILVCVHGFRFLSGYEVRKVYPNKFVQSDSSRY
FILNTLFHLPETHLLACLVDYFDNCPDFKRTNNGVTSSDQLLLTYKSIHQDIRAAVDWVH
LKGTLKQITVDNLETYVIKEPKLPKLLIRMRQSNRKTFILTNSDFLYTDKIMSFLLNETD
ESGKTIKKWTSYFDYVGVDARKPLFFGEGTALRRVDTETGALSIGRYSGKLKEGQIFSGG
SSDVFCNLLGAEGKDILYIGDHIFGDILKSKKKQGWRTYLVIPELTRELEVWQSRQDVFT
KLRDLDIALADTYKNLDSAAIDKPDITEIKTSIKEVTNMMETCYGQMGSLFRSGNRQTFF
ASQATRYADLYAASCVNLLHYPFSYLFRAPPQLMPHESTVEHTGELFEPTESSAFAPRGF
SFSDDNPSSCTLDLHRQISKNSTGSVCRCDDDDDDSTESESGESAQEPSTPVYEEKNGVS
PLDKI
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atggatacagagaagaaactgacttcaaacgaagttgaatatttaatggtaccaaaggaa
ggctgggtcaagagtactcccaaagaccccttggaattgaagatgccttacccctcccac
ccatttgaccaaaactctattgggatggacactcctgatggttcaaaggcattcaagaga
gacactgcaaacagagtgtttgtgaatagaagtcttagtctggataagatcaaattcttt
ggctttgatatggactatactctagcagtgtacaaatctcctgtgtatgaaaagaaagcc
tttcgtttaatctgtgaaaggttagcttccattggttacccaaaggatgtacttaacttt
gaatatgatgaatcattcccagctaggggtctcttctttgactgtgaactaggaaatctg
ttgaaggtggacacatatggaaacattcttgtttgtgtgcatggttttaggttcttaagt
ggttatgaagtgaggaaagtgtacccaaataagtttgtccagtctgactcttcaagatat
tttatattgaatacattattccacttgccagaaacacatttgttggcctgtctagtggat
tattttgacaactgtcctgattttaaaaggacaaataatggtgtaactagctctgatcag
ttgcttttgacctacaaaagcattcatcaagatattagagcagcagtagactgggtgcac
ttaaagggcacattgaagcaaattactgtagacaatctcgagacttacgttattaaagag
cctaaacttccaaaattactaattagaatgaggcaaagtaaccgcaaaacatttatactt
acaaacagtgacttcttatacacagataaaatcatgtccttcttgttgaatgaaactgat
gagtcgggaaagacaatcaagaagtggacatcttattttgattatgttggtgtagatgct
agaaaaccactcttctttggagaaggtacagcactgagaagggttgacacggagactgga
gctcttagcattgggagatactctggtaaactaaaggagggacaaatattctctggaggt
tcttcagatgtgttttgtaaccttttaggtgctgaaggaaaggacatactgtacattggg
gaccacatttttggtgatatcctcaaatccaagaaaaagcaaggatggagaacatacctt
gtgattccagaactgactcgagaactggaggtgtggcaatcgagacaagatgttttcaca
aagcttcgtgatcttgacatagcactagctgatacgtacaagaatttggactcggccgca
attgacaaaccagacatcacagaaataaaaacttccataaaggaggtaactaacatgatg
gagacatgttacggtcagatgggcagtcttttccgtagcggtaacaggcagaccttcttt
gccagccaagctacacgctatgctgatttatatgcagcctcttgtgtgaacctgctgcac
tatcccttcagctatctctttagggctccaccacaacttatgccacatgaatccacagtg
gagcatacaggagagctgtttgaacctacggaaagcagtgcctttgccccaaggggcttc
tcttttagtgatgacaacccatcatcatgtactttagatcttcacaggcaaatctcaaag
aactccactggaagtgtgtgtaggtgtgatgatgacgatgatgattctactgagtcagag
agtggtgaaagtgcgcaggagcctagcactcctgtttatgaggagaagaatggtgtgagt
cctttggacaagatataa

DBGET integrated database retrieval system