KEGG   Stylophora pistillata: 111323105Help
Entry
111323105         CDS       T05774                                 

Definition
(RefSeq) cytosolic phospholipase A2-like
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
spis  Stylophora pistillata
Pathway
spis00564  Glycerophospholipid metabolism
spis00565  Ether lipid metabolism
spis00590  Arachidonic acid metabolism
spis00591  Linoleic acid metabolism
spis00592  alpha-Linolenic acid metabolism
spis01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spis00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    111323105
   00565 Ether lipid metabolism
    111323105
   00590 Arachidonic acid metabolism
    111323105
   00591 Linoleic acid metabolism
    111323105
   00592 alpha-Linolenic acid metabolism
    111323105
Enzymes [BR:spis01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     111323105
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B C2
Motif
Other DBs
NCBI-GeneID: 111323105
NCBI-ProteinID: XP_022782134
Position
Unknown
AA seq 697 aa AA seqDB search
MAEKQALYRPCLVLDIKVVRGRNITLGTYSDWVDTPDPYVKLFIRTAPNGRKRTKAKNNT
ANPVWEETLKFYLDPNVKNILEITLMESDTFSDDLVDTKSFDLNELTIDETYKKTFVFKG
TSEVDVEMKVKTCSAVTDMRYSLNLCDEETDFRQKRKRVVFEAMRKLLRERGPKEIGEVP
SIAVLGSGGGFRAMVSLSGVFCALKEIGVLDCVMYTAGLSGSAWYLSTLYSHPEWPKAHP
CEIKRDLRKNVKDNWMWLLLTPSWMYNHVNIILDKRSRGQPVSFTDFFGYLVGETILKDR
KDVPKLSEQRYAVKDGAAPMPLYTCLHVKKNEVAQNFCEWLEFSPYEVGMAKYGTFMKTE
NFGSKYFCGKLVTPYPEPPLLYLQGIWGSALTIMLQRVLNEDQSPTDTVKNMSNSGDLRQ
ELQTDVLNDPISEDEESDEEMDLGAMDEKDSKDEDSEDPGFLKSIAESFVEKISFLKTRS
GRAGIVHNFLRGLKLMTTPVPSAEAKEVTDTADHLAVKAKRIYLVDSGLLFNSPYPPLLR
PERDVDIFLSFDFSAREKDNELSFNELYLAEQWARENNLKFPPINAKEQLQKDGIKEYYV
FTDLADPTCPVVVHFPLVNKTFKEQSKPGVPRTTAEEKKFANFSVFEDPDDYYSTFNFHY
PTEPFDRLSAVTEFNTLLGKQAIMDVIADCVRKRRGR
NT seq 2094 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaaaacaggccttgtacaggccgtgtttggtactcgatatcaaagtagtacgt
ggacggaatataaccctgggcacttattctgactgggttgatacaccggatccatacgta
aaactgttcattagaacagcaccaaatggcaggaagagaaccaaagcgaaaaacaacaca
gctaacccggtgtgggaagaaacgttaaagttttatcttgatccaaatgtgaaaaacatt
ttggagataactctgatggagtcagacacattcagcgacgatttggtagacacaaagtca
ttcgacttaaatgaattgacaattgatgaaacttacaagaaaacatttgtcttcaaaggg
acctcagaggttgatgttgagatgaaagtaaaaacatgctctgcagtcacagacatgagg
tacagcctgaacctttgtgacgaggaaactgattttcgtcagaagaggaaaagagttgtt
tttgaagccatgagaaaactgctcagagaacgaggaccaaaagaaattggtgaggtgccc
tcgattgctgttcttggctctggaggaggctttcgtgccatggtttccctcagtggtgta
ttctgtgctctaaaggagataggtgtgttagactgtgtcatgtacacagcaggactgtca
gggtccgcgtggtatctttccacgttatattctcatcctgagtggccgaaagcccatcca
tgtgaaatcaaacgtgatttgagaaaaaatgtcaaagataactggatgtggttgttgcta
actccatcatggatgtacaatcacgtaaacatcatcctggataagagatcacgtggacag
cctgtcagtttcacagatttctttggttatctggttggagaaactattctgaaagaccgg
aaagatgttccaaaattaagcgaacagcgctatgcagtgaaagatggtgcggctccaatg
ccactgtacacctgtcttcatgtaaagaagaacgaagttgcacagaacttttgcgaatgg
ctcgaattcagcccttatgaagttggcatggcaaaatatggcacgttcatgaagactgag
aattttggaagcaaatacttttgtggcaaattggttacaccatatcctgagcctccgcta
ctttatttgcaaggcatctggggtagtgctttgacaataatgcttcagcgagttctaaac
gaagaccagtcaccaaccgacacagtcaaaaacatgagcaactctggcgacttgagacaa
gagttgcagacagatgttttaaacgaccccattagtgaggacgaagaaagcgacgaagaa
atggatctcggtgccatggatgagaaggattcgaaagatgaggactctgaagacccaggt
ttcctgaagagtatagcggaaagctttgtggaaaaaatatctttcctgaaaacgcgatct
ggtcgagcaggcatagtgcacaactttttacgcggccttaagttaatgaccaccccagtc
ccctcggccgaagctaaagaggtcactgacaccgctgaccatttagctgtaaaggctaaa
cgtatctacttggttgacagcgggctcttgttcaattcaccatatcctcctctactcaga
cctgagcgagatgttgacattttcctgtcatttgacttcagtgctcgagagaaggacaac
gaactttctttcaatgagctgtatttggcagagcaatgggcaagagaaaacaatttgaag
tttccaccaattaacgccaaggaacagttgcaaaaggacggaatcaaagaatattacgtg
ttcactgatctcgcagatccgacctgtccggttgtagtgcatttccctcttgtcaacaaa
actttcaaggagcagagcaaaccaggagttccacgaacgactgctgaggaaaagaaattt
gcaaacttctccgtgtttgaagatcccgatgactattacagcacgttcaattttcattac
cccacagagccgtttgatcgtctgtcagcagtaacagaattcaacactctgttaggtaaa
caggccatcatggatgtcatagctgactgtgtgaggaaaagacgcggaaggtaa

DBGET integrated database retrieval system