KEGG   Stylophora pistillata: 111323246Help
Entry
111323246         CDS       T05774                                 

Definition
(RefSeq) uncharacterized protein LOC111323246
  KO
K00736  alpha-1,6-mannosyl-glycoprotein beta-1,2-N-acetylglucosaminyltransferase [EC:2.4.1.143]
Organism
spis  Stylophora pistillata
Pathway
spis00510  N-Glycan biosynthesis
spis01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spis00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    111323246
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:spis01003]
    111323246
Enzymes [BR:spis01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.143  alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase
     111323246
Glycosyltransferases [BR:spis01003]
 Glycan extension
  N-Glycan
   111323246
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MGAT2 GNT-I
Motif
Other DBs
NCBI-GeneID: 111323246
NCBI-ProteinID: XP_022782296
Position
Unknown
AA seq 419 aa AA seqDB search
MALTLILRRTFRCRSFKRTFIFAVVILVQLWLAIPALFGQRGDIWPQEFNVVFPRNFQAP
FVPLVIFSSYRPKYLERTLESISSSGSIVPSTPCLFILHHTKASTMDDINETYKVLGKIT
FCRKLVWTFGNEEEERSPEVLKAHWWNTMKKVFDEHDAFQLKHNETFSGDVLFVEDDLVV
AADFMEVMWYSLLVKNSVPNIHFSTLQGVGEENLVDHQPDAFVVSEVPLVQSIGYSFNSS
MWEYIKTFQDDALGHAEGDWPLYLGLMLLYNRNSTIFRIVSPTISRIWHVGDNDLGSSAD
PGASSKYKPDQFPPWKRARERRYLNRNKANVLPGVRDMHGRLCHPCEMESRTYKFSRGSY
NCRCLCPTSNLQKYVNWQMGAFVSDVNQGMHCTLVSHLMTMVVFVFVGILLFVYLMSSH
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggctttgacactgattctaaggagaacgttcagatgccgatcatttaaaagaacattt
atatttgcggttgtcatcttggtacaactgtggttagcaattcctgctcttttcggacaa
cgtggggacatatggccacaggaattcaatgttgtttttcctcggaatttccaagcccct
tttgttcctctggttatttttagctcctacagaccaaagtatttggaaaggacgttggag
tcaatttcttcctccggtagtattgttccctccacgccatgtttgttcattcttcatcat
accaaggcctcaacaatggacgatataaatgagacatacaaggtccttggtaaaatcaca
ttttgtagaaaacttgtgtggacatttggaaatgaggaggaagaacgtagcccagaagtc
ttaaaggctcattggtggaatactatgaaaaaagtatttgatgaacatgatgcctttcag
ttaaagcacaatgaaacatttagtggagatgtactgttcgttgaagatgacttagttgtt
gcggcagattttatggaggtgatgtggtactctctcctcgtcaaaaactctgtccccaac
atccactttagcacactccaaggagttggagaggagaatttagtagatcatcaaccagat
gcctttgttgtgagtgaggtaccacttgttcaaagcattggttattcatttaactcatct
atgtgggagtacatcaagacatttcaggacgatgctttaggacatgctgagggagactgg
cccctttacctaggtttaatgctactgtacaatagaaattcaactattttcaggattgtt
tcacctaccataagtcgtatctggcatgttggggataatgatcttggttccagtgctgat
cctggtgcaagcagtaaatataaacctgatcagtttcctccctggaaacgtgctcgagag
cggcgctatctcaatagaaataaggcaaacgttttaccaggagtcagggacatgcatgga
cgactgtgccacccatgcgaaatggagtcaaggacatacaaattttctcggggaagctat
aactgccgttgtctttgtccaactagtaatttacagaaatatgttaattggcaaatgggg
gcatttgtgtcagatgtcaatcaaggaatgcattgtacactggtatcacatttgatgaca
atggtcgtatttgtctttgttggtattttgttgtttgtttatttgatgtcctcacactga

DBGET integrated database retrieval system