KEGG   Stylophora pistillata: 111323389Help
Entry
111323389         CDS       T05774                                 

Definition
(RefSeq) dual specificity protein phosphatase 10-like
  KO
K20216  dual specificity phosphatase 10 [EC:3.1.3.16 3.1.3.48]
Organism
spis  Stylophora pistillata
Brite
KEGG Orthology (KO) [BR:spis00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:spis01009]
    111323389
Enzymes [BR:spis01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     111323389
    3.1.3.48  protein-tyrosine-phosphatase
     111323389
Protein phosphatases and associated proteins [BR:spis01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   MAPK phosphatases
    111323389
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DSPc Rhodanese Y_phosphatase PTPlike_phytase Init_tRNA_PT
Motif
Other DBs
NCBI-GeneID: 111323389
NCBI-ProteinID: XP_022782451
Position
Unknown
AA seq 342 aa AA seqDB search
MPPLLLVPRPAESKFGCMNRSSDMSSGKWKSVSSTELAQSIDGGGAGNSAEILIVDCRSL
VAFNGLHIRGAIHVNCTGIGRKRLSQGKAKLKDLISSAEGKEKFIRGGVGTTFVIYDELS
SDPEDCNPCRPICLVLQNLLKEGRNISVLKGGLKEFCRDYQNLCENAPVNHCDLADFPPS
PTTCDSCPGRPQGTPVTAILPFLYLGNEEGAADEALIDRLSIKYILNLTPRCPNFFSHRS
DLNYRQIKVNDSNQEDIAQHFDEAIQFIDEARERGSGILVHCHAGVSRSATVTVAYIMKQ
QGLCLGDAYKFVKELRPVISPNLNFMGQLLKYEKKKRNDESS
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgcctcctcttcttttggtaccaagaccggctgagtcgaagtttggatgtatgaatcga
tcctctgatatgagtagcggaaaatggaagagtgtctcgtcaactgaacttgctcaaagc
attgacggtggtggagcgggtaattcggcagaaattctaattgttgattgtagatcgcta
gtagcttttaatggactacacattagaggagctattcatgtgaattgcaccggaatagga
cgtaaaagactttcacaaggcaaggcaaaactaaaagacttgatttcttcagcggagggc
aaagagaagtttatccgtggtggagtggggacaacctttgttatctatgatgagttgtca
agtgatcctgaagactgcaatccttgccgtccaatttgcttagttttacaaaatctttta
aaagaggggagaaatatttcggttctaaaaggcggacttaaggaattctgtagggattat
caaaacttgtgcgaaaacgcccctgtcaaccactgtgacctcgctgacttcccgccttca
ccaacgacatgcgactcgtgcccagggcgccctcaaggaactcctgtgacggccatctta
cctttcttgtatcttggcaacgaagaaggcgcggctgatgaagccctaattgacaggttg
tcaattaagtacatccttaatttgactccccgatgtccgaattttttcagtcaccgatcg
gatcttaactataggcagattaaagtaaacgactcgaaccaagaggatatagcgcagcat
tttgacgaagccatacaatttattgacgaggcccgagaacgaggcagcggtatccttgtg
cactgtcacgccggtgtgtcacgctcggccaccgtgacagtagcatacatcatgaagcaa
caaggtctttgcttgggagacgcgtataaatttgtcaaagagctaaggccggtaatctca
ccaaacctcaacttcatgggacaactgctgaagtatgagaagaaaaagagaaacgacgag
agttcataa

DBGET integrated database retrieval system