KEGG   Stylophora pistillata: 111324504Help
Entry
111324504         CDS       T05774                                 

Definition
(RefSeq) uncharacterized protein LOC111324504
  KO
K17108  non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
spis  Stylophora pistillata
Pathway
spis00511  Other glycan degradation
spis00600  Sphingolipid metabolism
spis01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spis00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    111324504
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    111324504
Enzymes [BR:spis01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     111324504
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydr_116N DUF608 PAN_4
Motif
Other DBs
NCBI-GeneID: 111324504
NCBI-ProteinID: XP_022783819
Position
Unknown
AA seq 930 aa AA seqDB search
VRQIGKTVTSILTGKTDDLVPHLDALQFRNGPSFVYANQSFGLQQFCVLYTEPENVSTIR
FGWDTLGLRNYLFQNPGDPKMQRSPPMGMRSAVPLGGLGTGSFELRADGSIHEWTIENQT
PAGSAKLNQEALDLAVFGVRVQTGTSSNVALLRTHPPDGYPGVASMGYSGSFPVSKLTVR
DEQFGGISLDLYAYSALKPRDSKTSATPAVAFTFRINNPTEKTVNVSLMFNLPLGIQTAT
ARLGESYKDINMSTVSSTICSEACTKDPKCFSWQIEIKNKTCLFFNETFPHYWKPGFTSG
QKNTWNAHDSMLTLNRPGNYPQSGNTTILTEKSNNPSFMVSDSFGQIWKQFSTHGYLLSA
AKSFGGGFHGAAAINVTMEPGDENTLTMVLGWYYPNRDFTEEIVGNYYSNIFKSSEEAAL
IVSRDPASTLRSISDWHSSMILDSTKNSVQTLPEWLQDVLVNGLSFWRTGLYLRDGRWRQ
FEALDCIDIDSVHNDFQREIPYVIFYPDLVKKVMHAWAKYQSEDGHIVETLVMGCYSPTR
KMDSGPPNQRIMGDVTTVFIVETYHIYQWTNDTEFLRDLWPHVVHALDWLIYKGTNGTGL
PYKQQCTYDIEALNLYDHNVFNSFMYVLAMRAAQELGTIMQDRNVWREATIAMEFAKHVI
SEELWSEEDGYYHAWWDKKLGSPPWLMSDSLYAQVWAYTLGLGHLDDPRRLKSHLNKELE
INDTPYGLRVMFTGHPTNKSVGSCPQNISAGELNKLVAVRESIWVGGSPDWTTLQIHLGL
DPQNASHQAQKALDHVRSELNDQWDFHGLYSGPGYGLDGLPWCTSHYTFHMVLWHIPFAI
SGQYFSAPNSTLTFSPKFLCPYKIPFYTPFAIGTLQCSVIDKETMKFEMLSTSGDIYLQK
LVVSGFQYPKSVELKQGEVITWLSHDDILL
NT seq 2793 nt NT seq  +upstreamnt  +downstreamnt
gttaggcagatcggaaaaacagtgacttcaattctgacaggaaaaactgatgatcttgtc
ccacatcttgacgcacttcagttccgcaatggtccttcgtttgtttacgctaatcagagt
tttggcttgcagcagttctgtgtgttatatactgaaccagaaaatgtatctaccattcga
tttggctgggatacactgggactaagaaactacttgtttcagaaccctggcgatccaaag
atgcagcggtcacctccgatgggcatgcgtagtgctgttccactaggaggccttggaacg
ggatcatttgagctccgcgcagatggttcaatccacgagtggacgatcgagaaccagact
ccagcaggttcagctaaactgaaccaggaagccctggatctagcagtttttggtgtccgc
gtgcagactggtacctcaagtaatgtagcactgttgcgtacccaccctcccgatggctat
ccaggtgttgcttcaatgggttattctggctcattcccagtctccaagctcacggtaaga
gatgagcagtttggtggcatcagtcttgacctttatgcctattcggcgttaaaaccacgt
gattccaagacgtcagccactcctgccgtggcgtttacatttcgcattaacaacccaaca
gagaaaactgtcaatgtttcattaatgtttaacctaccattaggaattcaaacggccaca
gctagactgggggaatcatacaaagatataaatatgtcgacagttagttccactatttgc
tctgaggcttgtaccaaagaccctaaatgcttctcgtggcaaatagaaataaagaacaaa
acatgtttgttcttcaatgaaactttccctcattactggaagccgggcttcacttccggt
caaaagaacacgtggaatgctcacgactcaatgctgacactaaataggcctgggaactac
cctcagagtggaaatacgactattttgaccgaaaaatcgaacaacccttcattcatggtc
agtgacagttttggtcaaatctggaagcagttcagcacacatggttacctgctatcagca
gctaaatcatttggtggtggttttcatggagccgcagctattaatgttaccatggaacct
ggagacgaaaatactctaacgatggtattgggatggtattatccgaacagagatttcaca
gaggagatcgttggtaattactacagtaacatcttcaaatccagcgaggaagcagcttta
attgtatcacgtgacccagcctcgactttacggtccatttctgactggcactcgtcaatg
atacttgacagcaccaagaactcggtccagaccctgcccgagtggttacaagatgttctt
gtaaacggtttgagtttctggcgcacgggactgtacctccgtgatggaagatggcgtcaa
tttgaggcgctagactgcattgacattgattccgtccataatgacttccagcgagaaata
ccctacgttattttttatcctgacttggtcaagaaagtgatgcacgcatgggcgaagtac
cagagtgaggacggtcatattgtagaaactttagttatgggatgttactcacctaccaga
aaaatggacagcgggcctccaaaccagcgaataatgggggacgtgacaacggttttcatc
gtagaaacatatcacatctaccagtggactaacgatactgaattcctgagggacctatgg
ccacatgtcgtacatgctcttgattggctgatttacaaaggtacgaatggtactgggtta
ccttataaacagcagtgcacatatgatatagaggctctaaacctttacgatcacaacgtg
ttcaacagtttcatgtatgtgcttgcgatgcgggcagcacaggaattaggtacaatcatg
caagacaggaacgtatggagggaagccacgattgccatggaatttgcaaaacatgtcatc
tcggaagaactttggagtgaagaagatggttattatcatgcttggtgggataaaaagctt
ggatcacctccatggctgatgagtgattccctatacgcgcaagtttgggcctacactttg
ggtcttggacacttagatgatccaagaaggttgaaatcgcatttaaacaaggaacttgaa
ataaacgacactccatatggtctacgagtgatgtttactggccaccccactaacaagagc
gtgggctcgtgtccgcaaaacatctcagcaggtgaattaaacaaacttgtagctgtacgc
gagtccatttgggttggcggtagtcctgactggaccactctgcagattcacttaggtctt
gacccgcagaatgcctcgcatcaagcacagaaagctctcgaccatgtccgttctgagctt
aacgaccaatgggattttcacggtctctactcagggcctgggtacggccttgatggtctc
ccatggtgcacctcgcactatactttccacatggtactgtggcatattccttttgcaatc
tcgggccagtacttctcggcgccaaactccacactaacatttagtcccaaatttctttgc
ccttacaaaattccgttttatactccctttgccataggcactttgcagtgttccgtcata
gacaaagaaacaatgaaatttgaaatgttgtcgacgtccggtgatatttacttgcaaaaa
cttgtggtcagcggctttcagtaccctaagtcagtcgagctaaaacaaggtgaagtgatc
acatggctatcacatgatgacatcttactttaa

DBGET integrated database retrieval system