KEGG   Stylophora pistillata: 111326275Help
Entry
111326275         CDS       T05774                                 

Definition
(RefSeq) dihydropteridine reductase-like
  KO
K00357  dihydropteridine reductase [EC:1.5.1.34]
Organism
spis  Stylophora pistillata
Pathway
spis00790  Folate biosynthesis
spis01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spis00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    111326275
Enzymes [BR:spis01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.34  6,7-dihydropteridine reductase
     111326275
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short_C2 adh_short Epimerase
Motif
Other DBs
NCBI-GeneID: 111326275
NCBI-ProteinID: XP_022785969
Position
Unknown
AA seq 240 aa AA seqDB search
MAVARVLVYGGKGALGATCVSYFKSKDWWVASVDLFPNEEAHANVVVSKTDSWTEQNEEI
QPKVEEILDGNKLDAIICVAGGWAGGSAKSKAVVKNADLMFKQSVWTSLISASIASKHLK
ENGLLTLTGAQPSLGATPGMLGYGMAKAAVHQLVKGLADEKGGLPTNASVLAILPMTLDT
PGNRKGMPNADFNQWTPLEYVANLLFEWTQGSDVPPRGSLVKLNTQDGLSSYEIHTGELL
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atggcagtagccagggttttggtttatggcgggaaaggagctcttggagctacatgtgtg
tcttatttcaagtccaaagattggtgggtagcttcagttgacttgttccctaacgaagaa
gcacatgcaaatgtggttgtttctaagacagactcatggactgagcaaaatgaagagatc
cagcccaaggtggaggagatcctcgatggtaacaagcttgatgcaataatctgtgttgcg
ggtggatgggctggtggaagtgccaaaagcaaagctgttgtcaagaatgcagacttgatg
ttcaagcagagtgtttggacctctcttatttctgcgagtattgcctctaaacatttgaaa
gagaatggtttgttgacattaaccggagctcagccttcactgggagctacaccagggatg
ttgggttatggtatggccaaggctgctgtgcatcaacttgttaaaggacttgctgacgag
aaaggaggtctgccaaccaatgcatctgttctggctatcttacccatgacattagacaca
ccaggtaacagaaagggaatgcctaatgctgacttcaatcaatggacacccctagagtat
gttgccaacttgttatttgaatggacccaaggcagcgatgttccaccgaggggaagtttg
gtcaaactgaacacccaagatggactctcttcgtatgaaattcacaccggcgaacttctt
tga

DBGET integrated database retrieval system