KEGG   Stylophora pistillata: 111327094Help
Entry
111327094         CDS       T05774                                 

Definition
(RefSeq) N-acetylglucosamine-6-phosphate deacetylase-like
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
spis  Stylophora pistillata
Pathway
spis00520  Amino sugar and nucleotide sugar metabolism
spis01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spis00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    111327094
Enzymes [BR:spis01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     111327094
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-GeneID: 111327094
NCBI-ProteinID: XP_022786937
Position
Unknown
AA seq 429 aa AA seqDB search
MKRRHEGEPKLCQFKNCRLLRDSKLIEEDLWVTDGKIIDPRNVFWGEQVRADVQIDCNNL
IISPGFIDLQINGGFGVDFSSDPEKLEEGLRTVSKGLLQHGVTSYCPTIVTSSQASYNEI
LKKIKRTPGGAHGAEILGAHLEGPFINPEMKGAHKEHLMRQISTKGAQEIEDFYGSLDHV
SIITIAPELAGDSMESIQQLVKSNIVVSIGHSAANLSIAEKAANKGASFITHLFNAMLPF
HHRDPGIVGLLTSYDIPKPIFYGLIADGIHTHPTATRIAHRSHPNGLVLVTDAIAALGLS
PGLHKLGPMQVEINHEKATLKGTNTLAGSIASMDVCIQRFRKMSGCSTVEALEGATLHPA
QVLGIKHKKGTLNYESDADLVFLDEDLNVHATFIAGEPVWLRKEGLVTGVMQLKYSMIGS
KSKRVSLME
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaggcggcatgaaggtgaaccaaagttgtgccagttcaaaaactgccgtttattg
agagacagtaaattgatcgaagaggacctgtgggtgacagatgggaagatcattgatcca
cgaaatgtattctggggagagcaagttcgagccgatgttcaaattgattgtaacaattta
atcataagcccaggatttattgacctccaaataaatggtggatttggagttgatttctct
tctgatcctgaaaagttagaggaaggtttgaggactgtttccaagggtctcttacaacat
ggtgtgacatcctactgtcctacaattgtcacatcatcacaagcaagttacaacgagatt
ttgaagaagataaaaagaaccccaggtggagctcatggtgcagaaatattaggtgcccat
ttggaaggtccgttcatcaatcctgaaatgaaaggagctcacaaagaacacctgatgagg
cagatcagcaccaaaggagcccaagaaattgaggatttttatggttcattagatcatgtg
agcatcataacaatagctcctgaactggctggggacagtatggagtccattcaacagtta
gtaaagagcaacattgtggtatcaataggccactctgcagcaaacttgtccattgcagag
aaagcagcaaacaaaggtgcttcctttatcactcaccttttcaatgccatgttgccgttc
catcacagagatcctggaattgttggacttctcacaagttatgatatccctaaacccata
ttttatggactgatagctgatggaattcacacacatccaacagccacaagaatagctcac
agatcacatcctaatgggcttgtcttagtcactgatgctattgctgcccttggactttct
ccaggactacacaagctcggcccaatgcaagtggagataaaccatgaaaaagctaccttg
aaaggaactaacacacttgcaggaagcattgcctcgatggatgtttgcattcagagattc
cggaaaatgtcaggctgcagcactgtagaagcacttgagggtgctactctccaccccgcc
caggtactggggatcaaacataaaaaaggcaccttgaactatgaatctgatgcagactta
gtctttctagatgaagacctcaatgtgcatgccacgtttatcgctggtgaaccagtgtgg
ctgaggaaggaaggtttggtgacgggtgtgatgcaactgaagtacagcatgataggaagt
aaatcaaagagagtgtcacttatggaatag

DBGET integrated database retrieval system