KEGG   Stylophora pistillata: 111327939
Entry
111327939         CDS       T05774                                 

Definition
(RefSeq) retinol dehydrogenase 7-like isoform X1
  KO
K00061  11-cis-retinol dehydrogenase [EC:1.1.1.315]
Organism
spis  Stylophora pistillata
Pathway
spis00830  Retinol metabolism
Brite
KEGG Orthology (KO) [BR:spis00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    111327939
Enzymes [BR:spis01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.315  11-cis-retinol dehydrogenase
     111327939
SSDB
Motif
Pfam: adh_short adh_short_C2 DUF1776 KR
Other DBs
NCBI-GeneID: 111327939
NCBI-ProteinID: XP_022787995
Position
Unknown
AA seq 382 aa
MSGTGGKSVCFGALEREQEIELQGAMERVDSFYAVALLVAAMCALWIIKRLYKEEFLTDL
QQKYVLVTGCDSGFGRETALRLDSLGFNVFATCLTSEGQENLTAACSKRLTALHLDVTDS
KEIKETYKFVAQYLPENRGLWGLVNNAGIAKVGPIEWQTIEEFKQIADVNLWGLIDVTKV
FLPLIKKERGRIINLASIGGRTCLPHASAYSISKFGVEAFSDALRRELGPTGVKVSIVEP
GFFQTKITNPDNLKGQWQELWANLNHSLKEEYGEKFYETSVKNMLTGMVDTCASPYLYKV
VDAIVHSLTSRYPKTRYMVGWDAKLLWIWISRLPAGVGDAILNLLGDKAEPIVCTGALTR
SCENLVKLNGNNNSEKAFALGK
NT seq 1149 nt   +upstreamnt  +downstreamnt
atgagtggcactggtggtaaatcggtatgtttcggggctttggaaagagaacaagagatt
gaattgcaaggtgccatggagagagtagacagtttctacgcggtggctttgctcgttgct
gcaatgtgcgctttgtggatcatcaaacggctctacaaggaagaatttttgactgatctt
cagcagaagtacgtcttggtcactggttgcgattcaggattcggaagggaaactgcatta
cgactcgatagcctgggattcaatgtatttgcgacgtgtctaacgagcgaggggcaagaa
aatttaaccgcagcgtgcagtaaaaggctcacggccttgcacttggacgttacagactcg
aaagaaatcaaggagacatacaagtttgtggcgcagtatttacctgaaaatagaggcttg
tggggtctggtcaataacgctggcatcgctaaagttggaccgatcgagtggcagactatt
gaggagttcaaacaaatcgcagatgtgaatctttggggattgattgacgttaccaaggtg
ttcttaccactgatcaaaaaggagcgaggacgcatcataaatctcgctagtattggaggt
agaacgtgcttacctcacgcatcagcatactccatttccaagtttggcgtagaagcattt
tcggacgctctccgtcgtgaactgggtccgactggcgtcaaggttagcattgtggaacca
ggcttttttcagaccaaaatcaccaatcccgacaacctcaagggtcagtggcaggagctc
tgggccaacctgaaccacagtctaaaagaggagtatggggaaaagttctacgaaactagc
gttaagaacatgttaacaggaatggtagacacatgcgcctcaccctacctgtacaaagtt
gttgacgccattgtgcactcattgacgtcacgatatccgaagaccaggtatatggtcggt
tgggatgctaagctcctctggatttggatctctaggcttccagcaggtgttggagacgcc
atattaaatcttttgggtgacaaagctgaacctatcgtttgcacaggcgcattaacgcgg
tcgtgcgaaaacttagtgaaattaaacgggaacaataattcagaaaaagcttttgccctc
ggaaagtga

DBGET integrated database retrieval system