KEGG   Stylophora pistillata: 111331649Help
Entry
111331649         CDS       T05774                                 

Definition
(RefSeq) autophagy-related protein 16-1-like
  KO
K17890  autophagy-related protein 16-1
Organism
spis  Stylophora pistillata
Pathway
spis04136  Autophagy - other
spis04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:spis00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    111331649
   04136 Autophagy - other
    111331649
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:spis04131]
    111331649
   03029 Mitochondrial biogenesis [BR:spis03029]
    111331649
Membrane trafficking [BR:spis04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    111331649
 Others
  Rab GTPases of specific organelles
   Auto phagosome
    111331649
Mitochondrial biogenesis [BR:spis03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    111331649
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATG16 WD40 eIF2A WD40_like HOOK Fez1 Cytochrom_D1 GAS Exonuc_VII_L DUF4407 DUF4799 V_ATPase_I DUF1664 DUF848 COG5
Motif
Other DBs
NCBI-GeneID: 111331649
NCBI-ProteinID: XP_022792544
Position
Unknown
AA seq 562 aa AA seqDB search
MARGERQSWRKIISRKLEARDRVEWHCFRDIIREHNKLFENADTAKLRVVQLEIQVAQIQ
QEKIELHRRAQESSSLGGGAGGVGGGSEKVASLEQKLFKLQEELTELHRQKGENAQKLME
LNNTLRQKEQELLAKEGELHDLSNNLEEVDRARQRLEQTVTELTANCQMVKDELQALQLA
YSLLDERYRKVQTENEDLVARWMVQKAKDADKVNAENELQLRIRHEKQQNLLIDAAKEPV
VVNIPTSNQPGVPFCAIISIPSFPDKKFDAHEGEVNSARFSISGRLFVTGGADRRVKVWE
QVNGNYTIKGIMHGCNAGVMSVQTDPQEKLVLAGSHEGTCRVWTLTDQRLRHTLTGHSQK
VMAAKFFGGATKVVSGGHDRTLKIWDLRSKACMRTIFAGSSCNDIVIHEGFGSQVASGHL
DKTVRFWDVRSDNQSSVGEITLQGKITSLDLSPDMNYMLASARDDTVKLLDLRMNQVMST
CSADGFKVAVDYTRASFSPDGQYVICGSNDGSIFVWNASSAKLEKVLKEHSSSVVVCAWH
PDGSSLISCDRNKRAIIWTNRY
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgtggggaacggcaaagttggagaaaaataatatcaaggaaactcgaagcgagg
gatcgagtggagtggcattgctttagagatatcatcagggaacacaacaagttatttgaa
aatgctgacactgcaaaattaagagtggttcagttggaaatacaagttgctcaaattcaa
caggaaaaaattgagcttcatagacgtgctcaagaatcaagttcattgggaggaggggca
gggggtgttggtggaggatcagaaaaagtagcttccttagagcaaaagctgttcaagtta
caagaggaactgacagagcttcatcgtcagaaaggagagaatgctcagaaactgatggag
cttaacaatacgttacgacaaaaggagcaagaactgttggctaaggaaggagagttacat
gacttatcaaacaatttagaagaagttgacagggcaaggcagagactggagcaaacagtt
acagaattgacggcaaattgtcagatggtaaaggatgaactccaagcattacagcttgct
tactcattattggatgaaagatataggaaagtacaaacagagaatgaagatctagtagca
aggtggatggtacaaaaagcaaaggatgccgacaaagtaaatgcagaaaatgaattacag
ttgagaatacgtcatgaaaagcagcaaaatctacttatagatgcagcgaaagaaccagta
gttgtaaatataccaacttctaatcagccaggcgtacctttctgtgcaataatatctatc
ccttcatttcctgataaaaaatttgatgcacatgaaggtgaagtaaattctgccagattc
agtatttcaggtagattatttgtaacaggtggggcagacagaagagtgaaggtctgggaa
caagtcaatggaaactatacaataaaaggaatcatgcatggttgtaatgcaggtgtcatg
tcagtacaaactgaccctcaggaaaaacttgttctggcaggttctcatgaaggaacatgt
agagtatggactcttacagatcagagacttagacacaccctcacaggacattcacaaaag
gttatggcagccaaattttttggtggagcaactaaagtcgtttcaggaggccatgacaga
acattgaaaatttgggatcttagaagtaaagcatgcatgcggacaatttttgctggttca
agctgtaatgatatagtaatccatgagggatttggttcacaagtggcaagtggtcatcta
gacaagactgtcaggttttgggatgtcagatctgacaatcaatcaagtgttggagaaatc
acacttcaggggaaaataacatcactagatttatccccagacatgaactacatgttggcg
agtgcaagggatgacacagtaaaattgcttgacttgagaatgaaccaggttatgtcaaca
tgtagtgcggatggttttaaagttgcagtggattacacaagggcatcattcagtcctgat
ggccagtatgtcatatgtggttcaaatgatggtagtatttttgtatggaatgcatcctca
gcaaaacttgaaaaggttcttaaagaacacagttcttcagtggttgtgtgtgcgtggcat
cctgatggatcaagtcttatcagctgtgatcgtaacaagcgtgcaattatctggacaaac
cgatactga

DBGET integrated database retrieval system