KEGG   Stylophora pistillata: 111333045Help
Entry
111333045         CDS       T05774                                 

Definition
(RefSeq) sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1-like
  KO
K01335  complement factor B [EC:3.4.21.47]
Organism
spis  Stylophora pistillata
Brite
KEGG Orthology (KO) [BR:spis00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:spis01002]
    111333045
Enzymes [BR:spis01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.47  alternative-complement-pathway C3/C5 convertase
     111333045
Peptidases and inhibitors [BR:spis01002]
 Serine peptidases
  Family S1: chymotrypsin family
   111333045
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin VWA Sushi VWA_2 EGF DUF1986 hEGF cEGF
Motif
Other DBs
NCBI-GeneID: 111333045
NCBI-ProteinID: XP_022794304
Position
Unknown
AA seq 797 aa AA seqDB search
MIFTTSVSVIGIIFFSGCFANNVIAGTPCASNASNICYHGSQCVEENITSTGFKCLCVPG
YTGQRCEVDIDECDSKPCQNGGRCEDGVKKFTCTCARGFTGATCERRSKECTDPPGISNG
RVRSSKTIAVYVCNSGYKTIGIRVIRCRNNKWTGSPPTCQRGSKPQSCTTPRRIRHGDFK
PHEDDYLVGTTVTYFCRDNYRLRGSASVTCTNNRNWSPKQLPRCIKRAKCKDPGSPEHGR
RDGSLFLLGTQVRFSCDDGYELVGLNSLQCVPLCSSCRTVRWNGTTPTCEKNDPLRGLKR
VADRLREHFIDKLSWMTTDSLARAGLSSGAGGLDLVFIFDSSASVGSANFKKGVEFAKTI
IEEFGISASQMGTRVAVVTFSSTAKVIFNLKTNAMANKTEAIRTLENLDFIAGGTATRLA
LNKTIEEIVPEARKDSKRALFLITDGRSNIGGDPSADAVILRDFQKFEIYAIGVTDSVDE
KELRSIASEPFRTHVYLLKDFDDFAKLKQLISAKGNDYSECGIAGDTQLRNDDDENFRFV
GGREAKPGAWPWQAAIYVKGNFRCGGALIKGNWVLTVAHCFFYDGTVKPKDVVVRMGEHN
RFKEEGAEQNIRAKKLILHPNATRGNLHVGDDLALIRLKHPVKFSPLVRTVCLPEPTDVF
YVRPKKPCVVAGWGSSQKVSPDDLAGPPNEVLQQIQIKFVSQRDCRENATNAVAITENVV
CAGDASGKKDACKGDSGSPLVLRRSLDDSWAVIGLSSWGDGCATKGKYGVYTRLKSHLRW
IKRKTNRKNGNGKKNKD
NT seq 2394 nt NT seq  +upstreamnt  +downstreamnt
atgatatttactacgtccgtgtctgttatcggcataatcttcttttcaggatgctttgca
aacaacgttattgcaggaacgccctgtgcatccaatgcctctaatatttgttatcacggc
tcacaatgtgtggaagaaaacattactagtacaggattcaaatgcctttgtgttcctggc
tatactggtcaacgctgcgaagtggacatcgacgagtgtgattccaaaccatgtcagaat
gggggaagatgcgaagacggtgtcaaaaaattcacgtgtacttgtgcacgaggtttcacc
ggagcgacatgcgagaggagaagtaaggagtgcactgaccctccaggtatatcgaatggg
agggttagatcgtcaaagacaattgccgtgtacgtttgtaattctgggtataagaccatt
gggattcgcgtgatcagatgtagaaataataagtggactggaagtccacccacatgtcag
cgaggctcaaaacctcagtcatgtacaacacccagaagaatccgacatggagattttaag
ccacatgaagacgattacctagtcggtaccactgtcacttatttctgtagagacaattac
cggctcagaggaagtgcttcagtgacttgtaccaacaacagaaactggtcacccaaacaa
cttcctagatgtataaaaagagcaaagtgtaaggatccaggctctcccgaacacggtcgc
cgagacggaagtttgtttctactgggaactcaggttcgtttttcctgtgatgacgggtat
gagcttgttggtcttaattcacttcaatgtgttccgttgtgcagctcatgcaggacagta
cgatggaatggaacaactccaacgtgcgaaaaaaatgatccgttgagaggtttgaaaagg
gtcgcagatagactccgtgaacacttcatcgacaaactgagctggatgacaaccgacagt
ttggcaagagcagggttgtcctcgggagccggaggcctcgatctggtgttcatattcgat
agctcggcaagcgtcggtagtgcgaactttaaaaaaggagttgaattcgccaaaacgatc
attgaagagtttggtatatcggcatctcaaatgggaacaagagttgctgttgttacattt
agctcgacagctaaagtaatttttaatctgaaaacgaatgcaatggctaacaaaacagag
gctataaggactctcgagaacttagacttcatcgccggtggtactgctacacgccttgcg
ttgaataagaccattgaggaaatcgttcccgaagcccgaaaagacagcaagcgggctttg
ttcctcataactgatggcaggtccaatataggtggtgatcccagcgcagatgctgtgata
ctacgtgacttccagaagtttgaaatctacgctattggcgtaacagacagcgtggatgaa
aaagaactgcgcagcattgcttctgaacccttcagaacgcatgtctaccttctcaaggac
tttgatgactttgccaagcttaaacagctgatcagtgccaaagggaatgattacagtgaa
tgtggcattgcaggagatactcagctgagaaatgacgatgatgaaaacttccgctttgtc
ggtggaagggaggccaagccaggtgcctggccttggcaagcagctatctacgtgaagggt
aatttccggtgtggtggtgcacttatcaaagggaactgggttctaactgtggcgcactgc
tttttctacgatgggactgtgaaaccgaaagatgttgtcgtaaggatgggagaacacaac
cgattcaaagaagaaggtgctgagcagaatattagagcaaagaagcttatcttgcatccc
aatgcgacccgggggaacttacacgtaggagatgacttagctttgattcgccttaagcac
ccagtgaaattctcaccgttggtaagaactgtgtgtctcccggaacccacggacgtgttc
tacgtcagaccaaaaaaaccgtgcgtggtggccggttggggatcttctcaaaaggtttcg
ccggatgatttagcaggcccaccgaatgaagtcctgcaacaaattcaaataaaattcgta
tcccagcgcgattgccgtgaaaatgccaccaatgctgtagcaataacagaaaacgttgtc
tgtgctggtgatgcttcaggaaagaaagatgcatgcaaaggggacagtggttcgcctctt
gtgctcagacgttccctcgatgacagctgggcggtgattggtttatcgagctggggagat
gggtgtgccacgaaaggaaaatacggtgtgtatacgcgactgaaaagtcatttgcgctgg
ataaaacggaagacaaacagaaaaaatgggaatgggaagaagaacaaagattag

DBGET integrated database retrieval system