KEGG   Stylophora pistillata: 111333641Help
Entry
111333641         CDS       T05774                                 

Definition
(RefSeq) 39S ribosomal protein L53, mitochondrial-like
  KO
K17434  large subunit ribosomal protein L53
Organism
spis  Stylophora pistillata
Brite
KEGG Orthology (KO) [BR:spis00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:spis03011]
    111333641
Ribosome [BR:spis03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    111333641
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MRP_L53
Motif
Other DBs
NCBI-GeneID: 111333641
NCBI-ProteinID: XP_022795000
Position
Unknown
AA seq 100 aa AA seqDB search
MAAIRGASLKHVARVTVSFCPFDSKTATARDFLLRVSCRRMIDSNPKCQVISNFKNDGSE
PVVDIVFNDKDTLSMKTSNMKLMDVIATFNNKCKEKDVGE
NT seq 303 nt NT seq  +upstreamnt  +downstreamnt
atggcggccatcagaggtgcttcattaaaacatgttgccagagtaactgtttcgttctgt
ccttttgactcaaaaacggcgacagcaagagacttccttttaagagtttcatgtagaaga
atgatagactccaatcctaaatgccaggtcatatcaaatttcaagaatgatggatcagaa
cctgttgtggatattgtctttaatgacaaagatactctatcaatgaaaaccagcaacatg
aaattgatggacgtgattgcaacatttaacaacaaatgcaaagagaaggatgtgggcgaa
tga

DBGET integrated database retrieval system