KEGG   Stylophora pistillata: 111333930Help
Entry
111333930         CDS       T05774                                 

Definition
(RefSeq) nitrilase homolog 1-like
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
spis  Stylophora pistillata
Brite
KEGG Orthology (KO) [BR:spis00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    111333930
Enzymes [BR:spis01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     111333930
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-GeneID: 111333930
NCBI-ProteinID: XP_022795314
Position
Unknown
AA seq 258 aa AA seqDB search
MIYVSVKQFIATARYRFKLRSPLESSKEIRYRFFGFFNRREFAFITGQVMGDNQLTDSGA
TLVAVCQMNSTSDVERNLGICKDLINKAKSRGAKVVFLPECFDYVGENSEQSLSMAEPLE
STRMQSLCELAKELGVWLSLGGYHEKGPPDDKRLRNSHVIVNDHGSIVAVYRKIHLFDID
VKDGPRLKESDTCIPGDQIVPPVPTPVGNVGLAICYDVRFPELSLILAQQGADILTFPSA
FTQITRSAHWEVCTNNVY
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgatttatgtatctgtcaaacagttcattgctactgcacgatatagatttaaactcaga
tcaccacttgagagctctaaagagataaggtaccgtttttttggattcttcaatcggcga
gaatttgccttcataaccgggcaagtcatgggagacaatcagctgaccgattctggagcc
actctcgtcgcagtttgtcagatgaactccaccagtgatgtagaacgtaacctgggaatt
tgcaaagatttgataaacaaagccaagtccagaggggccaaggttgtgtttcttcctgaa
tgttttgactatgtgggagaaaacagtgaacaatctttgtcaatggcagaaccactggaa
agtacaagaatgcaaagtttatgtgaattagcgaaagaactgggtgtgtggctctctctt
ggtggataccatgaaaagggcccaccagatgacaagaggctgcgtaactcccatgtcatt
gttaatgaccacggctccatagttgcagtgtatcgtaaaatacatctgtttgatattgat
gtaaaagatggacccaggcttaaggagagtgacacctgtatccctggtgaccagatagta
ccacctgtgcccacccctgtggggaatgttggcctggccatttgttatgatgtacgtttt
ccagagctgtcccttattttagcccagcagggagccgacatcttaacattcccatcagca
tttactcagatcacccgatcagcacactgggaggtttgtacaaataatgtttactga

DBGET integrated database retrieval system