KEGG   Stylophora pistillata: 111333994Help
Entry
111333994         CDS       T05774                                 

Definition
(RefSeq) guanylate cyclase soluble subunit beta-1-like
  KO
K12319  guanylate cyclase soluble subunit beta [EC:4.6.1.2]
Organism
spis  Stylophora pistillata
Pathway
spis00230  Purine metabolism
spis01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spis00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    111333994
Enzymes [BR:spis01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     111333994
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc HNOBA HNOB AhpC-TSA_2 zn-ribbon_14
Motif
Other DBs
NCBI-GeneID: 111333994
NCBI-ProteinID: XP_022795404
Position
Unknown
AA seq 625 aa AA seqDB search
MYGFVNQALQDLVLRESSFGTWEEILKKANIDLGETGEFNQRRIYDDQNTFDLLRVASEV
LGLSHNVILEKFGEIFFEYCQNSGYEKMLDSLGSNLKDFFNSLDALHEHLLYIFPGMRAP
SFHAKDNPDGNGLEILYYSERSGLEYMVVGVVKAVAREVYNTKVNIEVAVPTNQEKTWSK
IIVTPENYEDMIHLKQHDEQIQKIEQKLELVTLGSRISSQTFCQACPFHILFDNEMVIYQ
AGISLLRVLPSIKVGETKVGEMFECIRPHISLTFDNILQFINKVYVVKTKEGLLDSATLT
TVSEDDVGTLDFPTMRFRGQMMYLPECDSIMFLCSPSVLNLDGLNEIGLYLSDIPIHDAT
RDLILLSEQHNAESRLSQRLEILTDKLQQTSRELQQEQQLTDRLLYSILPSSVANDLRLK
RPVMAKKYEIVTIMFSGIVDFTNYCNQSSEPMEIVELLNDTYIRFDALADKNNEVFKVET
VGDKYMAVSGLPTKCTNHTANIANLALDMIDIVQEVNAQGRKMQITVGIHSGEVVAGVVG
QKKPRYCLFGNTVNLTSRTETTGLRGKINVTEYAYRSLLCQPHDHFVFKKRGPVTMKGKP
EPMITYILQRKEHRDVLRTVTCSGL
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
atgtatggctttgtaaaccaagctttgcaagatttggtattgcgagagagcagcttcgga
acttgggaagaaatattgaagaaagcaaatatcgatttaggagaaacaggagaattcaat
caacggcgaatatatgatgatcaaaatacatttgacctgttaagagtcgcttcggaagtt
ctcgggttatcgcacaatgtgatcttggagaaatttggggaaatattcttcgagtactgc
caaaactctggctatgaaaaaatgttggacagtcttggaagcaacctcaaggactttttc
aacagtctggatgctctgcatgagcatctgttgtatattttccctggtatgcgggcacct
tcatttcacgccaaagataatcctgatggcaatgggttagaaatcctttattattctgaa
aggtcagggcttgagtatatggttgtgggtgttgtgaaagcagtggcaagagaggtttac
aacaccaaggtgaacattgaggtagctgtgcctacaaaccaggagaagacttggtcaaag
attattgttacacctgagaactatgaagatatgatacatctgaaacaacatgacgagcag
attcaaaagattgaacagaagttggagcttgttacattggggtctcgcatcagtagccag
actttctgccaagcatgtccctttcacattctctttgacaatgaaatggttatttaccaa
gctggaatttcgttgctgcgagttttaccctctattaaagttggtgaaactaaagtgggt
gaaatgtttgaatgtattcgtccacacatttcgctgacatttgataatattttgcaattt
atcaataaggtgtatgttgttaaaacaaaagaaggacttctagactctgctaccttgaca
acagtttctgaagatgatgtgggtaccttggattttcctacaatgagatttcgtggtcaa
atgatgtaccttcccgaatgtgatagcattatgttcctatgttctccaagtgttctcaat
ttggatggtctcaatgaaattggtttgtacctcagtgacattccaattcatgatgccaca
agggatctcattctactctctgaacagcataatgcagaatcacgtctgtctcagcgactt
gagatactgactgacaagcttcagcagacctcacgtgaactgcagcaggagcagcagctc
actgatagactcctctacagcatcttaccgtcatcagttgcaaatgacctcagactgaag
cgaccagtgatggccaaaaaatatgagattgtgacaattatgttcagtggtattgtggat
tttacaaattattgtaatcagagcagcgaacctatggaaatcgtggaacttttgaatgac
acatatatcagatttgatgctctggcagacaagaacaatgaagtttttaaggttgagaca
gttggagacaaatacatggctgtgagtggcttaccaacaaagtgcacaaatcacactgca
aacattgcaaatcttgctcttgacatgatcgacattgttcaggaagtgaatgcacaaggg
agaaagatgcagatcacagttggcattcattctggagaggttgttgctggcgttgttgga
cagaagaaaccccgttactgcctatttggaaacactgtcaacctgacaagtcgtacagaa
actactggactgcgaggaaagataaatgtgacagaatatgcctacaggtcactgctgtgc
cagccacatgatcactttgtgttcaaaaagcgaggacctgttactatgaagggaaaacca
gaaccaatgataacatacatcttacagaggaaggaacacagggacgtgcttaggacagtg
acatgctcagggttgtag

DBGET integrated database retrieval system