KEGG   Stylophora pistillata: 111334607Help
Entry
111334607         CDS       T05774                                 

Definition
(RefSeq) carnitine O-palmitoyltransferase 1, liver isoform-like
  KO
K08765  carnitine O-palmitoyltransferase 1, liver isoform [EC:2.3.1.21]
Organism
spis  Stylophora pistillata
Pathway
spis00071  Fatty acid degradation
spis01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:spis00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    111334607
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:spis03029]
    111334607
Enzymes [BR:spis01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     111334607
Mitochondrial biogenesis [BR:spis03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    111334607
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf
Motif
Other DBs
NCBI-GeneID: 111334607
NCBI-ProteinID: XP_022796133
Position
Unknown
AA seq 649 aa AA seqDB search
MYENPRSQSKLTLLWGAMVKLCAGHYPKLYSYQNSLPRMPVPNLNETCKGLLRSVKPILS
EEEYKKMETLAKDFEKNLGPKLQFILKLKSWWAPNYHTDWWEKYVYCMGRSPLPINSNYY
CLDQHWHPTYVQASRAATMSYLILKYYQEIETEHLEPLLIRKTIPICMSQYERTFKTTRI
PKEDVDEIVHFEHDEHEHIAVFCGGNCYMLPVTDKGKFISVLDLESQFEWIVADAKHSDV
TKDQPDGSVPALTALPRTEWAKIRKEYFSESLNRSTLEAIEEAMFVVILDENSFTDLSER
AKYLLHGDGRSFWFDKSFCLMVFSDGRCGINAEHAWADAPVIGHMLEYALTFEYIYRTYN
DKGKCTPIGGAHRSASLRTHNLQKPSRLYWDITPKLAHIIEDAVKFAQKNNEDIQHKVIV
HDAFGKGFIKSVKISPDAFIQLALQLAYYRDSNGRHPLTYESSMTRLYLQGRTETVRSLT
IEAKDFVLAMLDDTVPPEEKYKLLHKAADLHAKQYKDCMNGKGIDRHLFALFVVCRGQGY
ESEFLKSALTLPWTLSTSQQPQQQMAGTHFSVTEPELTHLISPGGGFGPVADDGYGVSYM
VPDDHRIFFHISSKISSKESNSDRFVKLLFESLSDIKTLHDTVRAKKAK
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgtatgagaacccaagatcacagagcaagctgactctattgtggggtgcaatggtaaag
ctttgtgctggtcattatccaaagctgtacagttatcaaaacagccttccaagaatgcct
gtaccaaatctgaatgaaacttgtaaagggttgttgcgttctgtgaagccaatcttaagt
gaggaagagtacaaaaagatggaaactcttgctaaggattttgaaaagaaccttggtccc
aagctccagtttattttaaagttgaaatcatggtgggcaccaaattatcacacagattgg
tgggaaaaatatgtgtactgcatgggccgttctcctttgcctatcaacagtaactactat
tgtttagatcagcactggcacccaacgtatgttcaagcatcaagagctgcaaccatgagc
tacctcattctgaagtattatcaggagattgaaactgagcatcttgaacctctgttgatc
agaaaaaccattcctatctgtatgtcacagtatgagagaacattcaagacaacgagaatt
ccaaaagaggatgtggatgaaattgttcattttgaacatgatgaacatgagcacatagct
gtcttttgtggcgggaattgctacatgttgcctgttactgacaaaggtaaattcatttcg
gtgctggatttggaaagccagtttgagtggattgttgctgatgctaaacattctgatgtt
accaaagaccagcctgatggtagtgtaccagcactgacagctctgccaagaacagagtgg
gccaaaatcagaaaagaatacttttctgagagtctaaatcgatcaaccctggaggctata
gaagaggctatgtttgtggtaattctggatgagaattccttcactgatttgagtgaacgc
gctaagtatctactgcatggtgatgggcgaagcttttggtttgataaaagtttctgtctg
atggtgttttcagatggtagatgtggaatcaatgctgaacatgcctgggctgatgcacct
gtcattgggcacatgttggagtatgcccttacctttgagtacatttatagaacatacaat
gacaagggtaaatgcactcctattggtggtgctcacagaagtgctagcctgaggacacac
aaccttcaaaagccttccaggttatactgggatataactcctaaacttgcacacatcatt
gaagatgctgtcaagtttgcacaaaagaataatgaagacattcagcataaagtcatagtt
catgatgcatttggaaaaggcttcatcaagagtgtaaagataagtcctgatgcatttatc
cagttggctttacaacttgcctattacagagattcaaatggaagacatccactcacatac
gagtcctccatgacacgcctctacctccaaggaaggacagaaactgtgcgcagtttaaca
attgaagctaaagattttgttcttgccatgttagatgacacagtccctcctgaagaaaaa
tataaattacttcacaaagctgcagatcttcatgccaagcagtataaggactgtatgaat
ggaaaaggcattgatagacatctttttgcactctttgttgtgtgcagaggtcaaggctat
gagagtgagttcttgaagagtgcattaacccttccatggacactgtctaccagccagcag
cctcaacaacaaatggcgggtacccactttagtgtcacagagccagaacttacacatttg
atttccccaggaggtggttttggtccagttgctgatgatggttatggtgtttcctacatg
gttcctgatgatcacaggattttctttcacatttcctctaagatatcctctaaagagtca
aactcagaccgatttgtcaaacttttgtttgaaagcctgtcagacataaaaacacttcat
gatactgtcagagctaaaaaggctaaataa

DBGET integrated database retrieval system