KEGG   Stylophora pistillata: 111335631Help
Entry
111335631         CDS       T05774                                 

Definition
(RefSeq) 5-hydroxytryptamine receptor 4-like
  KO
K04160  5-hydroxytryptamine receptor 4
Organism
spis  Stylophora pistillata
Pathway
spis04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:spis00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    111335631
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:spis04030]
    111335631
G protein-coupled receptors [BR:spis04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    111335631
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srv T4SS_CagC DUF742
Motif
Other DBs
NCBI-GeneID: 111335631
NCBI-ProteinID: XP_022797346
Position
Unknown
AA seq 339 aa AA seqDB search
MNSIQNESLVSETNSSNSSASNLTTALHAAVIIFIMTLIILGNLLVLIVTYRQRSRPSVR
VANMFIANLAVVDLSIAVLLFPFSVVTILLRRWPFGEALCKFNGATNMMAGAASILIMAV
ISFDRYRAIVSPPGSKITPKQAWVLLAIVWTWSIIIGVLPVLGWNQYAHSSLSTMCKISF
SEGRGYILLVIISCFVIPLLTMFYCYLRIFLKVRFHKRQVQRWSDNRQSQKNFRRETKTA
QVVFTVLFVFVVCWTPFVIVHFLQSLPTISISRIVFHSVTLVAGVHSACNPIIYITMNRT
FRNELHQVCQCVICGRVKCCGADNLVQPLSFETSFTQRS
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgaactcgatacaaaacgaaagcttggtatcagagacgaactcttccaattcaagtgca
agtaatttgacaacagctcttcacgccgctgtgatcatctttataatgaccttaataatt
cttggaaatcttctggtgctaattgtaacttaccgccaaagaagccgtcctagcgtgcga
gtagcaaacatgttcattgccaatctcgctgttgtggatctctcaattgcggtattactg
tttccattttctgttgtgacgattttgcttcgccgatggccctttggagaggcgttatgt
aagttcaatggcgccactaacatgatggcgggtgcagcttctattctaataatggcggtt
atcagctttgacaggtatcgtgcaatagtttccccaccgggcagtaagatcacccctaaa
caggcctgggtactactagccatagtctggacgtggtccatcatcattggtgttctccca
gttcttggttggaaccaatacgcacacagctctctgagcaccatgtgcaagatttctttt
agcgagggacgcggctacatcctccttgtgataatcagctgttttgtgatcccattatta
acaatgttctactgctatctacgaattttcctcaaggtgcgtttccacaagaggcaagtg
caacgatggagtgacaacaggcaatcacaaaaaaattttaggcgtgaaacgaagacagcg
caagtggttttcacggtgcttttcgtttttgttgtgtgttggaccccgtttgtcattgtc
cattttctgcagtcacttccgacaattagcatttcacgaattgtttttcattcagtgact
cttgtagcgggcgtgcattctgcctgtaacccaatcatctatatcacgatgaacagaaca
tttcgtaacgaattgcaccaagtatgccagtgcgtcatttgtgggcgagtcaaatgctgt
ggtgctgacaaccttgtacagccactcagctttgaaaccagtttcacgcaaagatcatga

DBGET integrated database retrieval system