KEGG   Stylophora pistillata: 111336505Help
Entry
111336505         CDS       T05774                                 

Definition
(RefSeq) NEDD8-conjugating enzyme UBE2F-like
  KO
K10687  ubiquitin-conjugating enzyme E2 F [EC:2.3.2.23]
Organism
spis  Stylophora pistillata
Pathway
spis04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:spis00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    111336505
Enzymes [BR:spis01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     111336505
Ubiquitin system [BR:spis04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   111336505
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UQ_con
Motif
Other DBs
NCBI-GeneID: 111336505
NCBI-ProteinID: XP_022798348
Position
Unknown
AA seq 188 aa AA seqDB search
MITLAKKIKEERDKKEKGDHGIGNTKSGRTSIRDKLLTKEVTELEENVPESCQVHFKDPN
ILHEFTLTVTPGEGYWKDGIFIFHIMIPEEYNIKPPNVWCETKIWHPNISENGEVCLSLL
REHTLDGSGWAPTRKLKDIVWGLNSLFTDLLNFDDPLNVEASELYFKNKESFRRRVEDYI
RLYASPRR
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgattactctcgcaaagaagattaaagaagagcgggataagaaggaaaagggtgatcac
gggataggaaacacgaaaagcgggagaacatctattcgcgacaaattgctcacgaaagaa
gtgacagaactcgaggaaaatgtaccggaatcctgtcaagttcacttcaaggatccaaac
attcttcatgagttcactctgactgtaacaccaggagagggatattggaaggatggaatt
tttatatttcatattatgataccagaagagtataacataaagccacctaatgtttggtgt
gaaacaaaaatctggcatccaaacataagtgagaatggtgaagtctgcttgagcttgttg
agggaacacactcttgatgggtctggatgggccccaacaagaaaattaaaggatatagtg
tggggcctgaattctttatttacagacttgttgaattttgatgacccacttaatgtagag
gcttcggaattatatttcaagaacaaggaatcatttagaagaagagttgaagactacatc
agactgtatgcatcccctagaagataa

DBGET integrated database retrieval system