KEGG   Stylophora pistillata: 111336819Help
Entry
111336819         CDS       T05774                                 

Definition
(RefSeq) estradiol 17-beta-dehydrogenase 8-like
  KO
K13370  17beta-estradiol 17-dehydrogenase / 3alpha(17beta)-hydroxysteroid dehydrogenase (NAD+) / 3-oxoacyl-[acyl-carrier protein] reductase alpha subunit [EC:1.1.1.62 1.1.1.239]
Organism
spis  Stylophora pistillata
Pathway
spis00061  Fatty acid biosynthesis
spis01100  Metabolic pathways
spis01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:spis00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    111336819
Enzymes [BR:spis01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.62  17beta-estradiol 17-dehydrogenase
     111336819
    1.1.1.239  3alpha(17beta)-hydroxysteroid dehydrogenase (NAD+)
     111336819
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short_C2 adh_short KR 3Beta_HSD Epimerase Polysacc_synt_2 3HCDH_N GDP_Man_Dehyd AdoHcyase_NAD
Motif
Other DBs
NCBI-GeneID: 111336819
NCBI-ProteinID: XP_022798716
Position
Unknown
AA seq 275 aa AA seqDB search
MYHSIIRYDFQGLESGESPKMAAAANLLVGRLALVTGGGSGIGRAVCQALAAEGASIVVT
DLNSQGAQDTTDNLSKHADNKHMNYSLDVSSGEEVQKVLECIVSEFKKPPCILVNSAGIT
KDEFLIKMDEKKFDKVIEVNLKGTFLVTQAVAKLMVSQRVMNGSIVNLASISGKMGNLGQ
VNYAASKAGVEGLTRTCARELARFGVRCNAILPGFIKTPMTDAVPEKVLEQVKKQIPLGR
FGQPSDIADVVTFLASDRSSYITGASIEVAGGLAM
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgtaccactctataattcggtatgattttcaaggcctcgagagtggggaatcaccaaag
atggcggccgctgcgaaccttcttgttggtcgtttagccttagttactggtggtggtagt
ggcattggtcgagcagtttgccaagctttagccgcagaaggagcaagtattgttgttaca
gatctaaacagtcaaggagcacaggacactaccgacaacctttcaaaacatgcagacaac
aaacacatgaactactctttggatgtttcaagcggagaggaggtacaaaaagtgcttgag
tgcatcgtcagtgagtttaagaagccgccgtgtatcttagtcaactcagctgggatcaca
aaagatgaattcttgataaagatggatgaaaaaaagtttgacaaagttattgaagtgaat
ctcaagggaacatttcttgtcacacaagcagtagctaaactaatggtcagtcaaagagtt
atgaatggatcaattgtaaatcttgccagcatatcaggaaagatgggaaatcttggtcaa
gtaaactatgctgcttccaaagctggcgttgaaggtttgacaaggacctgtgcaagggag
ctggcaagatttggtgttagatgtaatgcaattctgcctggcttcattaaaaccccaatg
acagatgctgtcccggaaaaagttcttgaacaggtaaagaaacagatccctcttgggcga
tttggacaaccatcagacatcgctgatgtggtaacattcctcgcttctgacagaagtagt
tacattacgggagcaagcattgaagttgcaggtggccttgctatgtaa

DBGET integrated database retrieval system