KEGG   Stylophora pistillata: 111337104Help
Entry
111337104         CDS       T05774                                 

Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type II subunit delta-like
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
spis  Stylophora pistillata
Pathway
spis04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:spis00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    111337104
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:spis01001]
    111337104
Enzymes [BR:spis01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     111337104
Protein kinases [BR:spis01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   111337104
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kinase-like Pkinase_fungal Kdo RIO1 YrbL-PhoP_reg FTA2 Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 111337104
NCBI-ProteinID: XP_022799071
Position
Unknown
AA seq 293 aa AA seqDB search
MANLELRKFGQDFEMKDFIGQGTFAKVFKCMERKTGECFAVKEFQTEGANFDREVVKNEV
EIWRTLQHRNIVSLYKRYYENGGHIWVVLEFVNGKTILDEVVNKTVFTEEETRGIMEQLI
ESLKYLHRKRIVHRDIKADNILLEKREGKPVVKLTDFGLARRLPVDCDVIKCRAEGTPLY
LAPETILADPIGPAVDIWACGVILFLLLVGYPPFWHSDDRKLMLLIVEGCYSMPARYWDR
VSDDAKDLVKRLLVVYPHKRVTAFKALNHPWISDFEENEDKGIETYTRSLVSR
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atggcgaacttggagctacggaagtttggtcaggatttcgaaatgaaagacttcataggg
cagggaacctttgctaaagtgttcaaatgcatggagcgaaagacaggtgaatgttttgca
gtcaaagaatttcaaactgaaggggctaattttgacagagaagtagtcaaaaacgaagtg
gaaatttggaggactttacagcatcgcaacattgtctcattatacaaacgctattatgaa
aacggcgggcacatttgggtggtgctagaattcgtgaatggaaaaactattttggacgaa
gttgtaaataagactgttttcactgaagaagaaactcgaggaataatggaacagcttatt
gaaagcctcaagtatcttcaccggaaaaggattgttcatcgagacatcaaagccgataat
atccttctcgaaaagagagaaggtaaacccgtcgtaaaacttacagattttggactagcg
cggcgacttccagtggattgcgacgtcatcaaatgtagagcggaaggcacgcctctatat
cttgcgccggaaacaatcttagcggaccctatcggtccagcggttgacatatgggcatgc
ggagtaattctgtttttattactcgtgggctatccgccattttggcacagcgatgatagg
aaattgatgttacttattgtcgaaggatgttacagcatgcctgcgcgctactgggaccga
gtgtcggatgacgcaaaagatcttgtgaaacgattgttagtggtttatcctcacaaacga
gtaactgctttcaaggcattaaaccatccgtggatctcagactttgaggaaaatgaggac
aagggaatcgaaacctatacaaggagtctcgtttcaagataa

DBGET integrated database retrieval system