KEGG   Stylophora pistillata: 111338102Help
Entry
111338102         CDS       T05774                                 

Definition
(RefSeq) threonine synthase-like 2
  KO
K06037  O-phospho-L-threonine phospho-lyase [EC:4.2.3.-]
Organism
spis  Stylophora pistillata
Brite
KEGG Orthology (KO) [BR:spis00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    111338102
Enzymes [BR:spis01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.-  
     111338102
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-GeneID: 111338102
NCBI-ProteinID: XP_022800256
Position
Unknown
AA seq 485 aa AA seqDB search
MKYRSTRGKVQADSFEDVLFSGFTSDGGLFMPEKIPVVDNCTLGKWKNLSYQELVCEVTS
LFIPAEEIPPEKLKDLVKNAYAEFQHKNIVSLAAVNNFHVLELFHGKTLAFKDFALACVG
VFIDYFLNKRKKHVITVVSTSGDTGSAAIESVRKSKWVDIIVMYPEGRCSQIQELQMTTI
LDKNVHVIRGEGTSDDLDFPMKKCFSDDAFVKSNNLCVINSINWCRIMVQTVHLLYGYLR
VCPDVGDTVKFVIPTGALGHCTAAMCLYKMGVPLQVVCAVNENDIVHRTLSVGNFSSSGD
VRHTWSCSMDIEVPYNMERLLLLFSDMNYGRVDSLMRDFEHNNSLMIPEDLKEKMCKVLS
SASVSCDQTLQTMKECWDENQYLLCPHTAVGVKVVWDQRHTTDQQTPIVCVATASPAKFP
EAVRAAGIKMPPYPQLAELFTSPTRYTEMKKGEDWYQILRDMIKDISKTPYNINNGIENE
SEDKF
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgaaataccgtagcactcgaggaaaagtgcaggcagactcatttgaagatgttctattc
agtggcttcaccagcgatggtggactgttcatgcctgagaaaatcccagttgttgataat
tgcacactaggaaagtggaagaatctttcatatcaggagctggtgtgtgaagtgacttca
ttgtttatccctgcagaagaaataccaccagagaaattaaaagatcttgttaaaaatgca
tacgctgaattccaacacaagaacattgtttccttggcggcagtgaacaacttccatgtg
ttagagttgtttcatggcaagacattggcatttaaggattttgctttggcatgtgttggg
gtattcatagattattttctgaacaagagaaagaaacatgttattactgtagtgtcaact
tctggtgatacaggcagtgctgccattgaaagtgtaaggaaatcaaagtgggttgatatc
atagtcatgtatcctgaaggacgctgtagtcagattcaggaactacagatgacaaccatt
cttgacaagaatgtacacgtcatcagaggagaaggtacatcagatgacttggattttcca
atgaagaagtgtttttcagatgatgcatttgtaaaatcaaataatctttgtgtgataaac
tctatcaactggtgtcgcataatggtacaaacagtgcatcttctttatggttacttgagg
gtttgccctgatgttggggacacagtaaagtttgtaataccaacaggtgcacttggacat
tgcacagctgccatgtgtctgtataaaatgggtgtccctctgcaagtggtgtgtgctgtc
aatgagaatgacattgtgcacagaaccctatctgttggcaactttagctccagtggagat
gttaggcatacatggtcatgttctatggatattgaggttccttacaacatggaacgtctg
ctgttactcttttctgacatgaattatggtcgtgtagattcactgatgagagattttgaa
cacaataattcactgatgatacctgaagatttaaaagaaaagatgtgtaaggtcttgtca
tctgcctctgtgtcatgtgaccaaacactacaaacaatgaaggaatgctgggatgagaac
cagtacctcctctgcccacacacagctgttggtgtcaaagtggtctgggaccaaagacat
accactgatcaacagacacccatcgtatgcgtggccacagcaagtcccgccaaattccca
gaggccgtgagggctgctggcattaaaatgccgccgtacccgcagttagctgagctattc
acgagtcccacaaggtacacggaaatgaagaaaggagaggactggtatcaaatattgagg
gacatgataaaagatatttccaaaacaccttacaacataaacaatggcattgaaaacgag
agtgaagacaaattttaa

DBGET integrated database retrieval system