KEGG   Stylophora pistillata: 111338391Help
Entry
111338391         CDS       T05774                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: titin-like
  KO
K12567  titin [EC:2.7.11.1]
Organism
spis  Stylophora pistillata
Brite
KEGG Orthology (KO) [BR:spis00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:spis01001]
    111338391
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:spis04131]
    111338391
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:spis04812]
    111338391
   04147 Exosome [BR:spis04147]
    111338391
Enzymes [BR:spis01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     111338391
Protein kinases [BR:spis01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   111338391
Membrane trafficking [BR:spis04131]
 Others
  Actin-binding proteins
   Others
    111338391
Cytoskeleton proteins [BR:spis04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     111338391
Exosome [BR:spis04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   111338391
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set Ig_3 Ig_2 ig V-set Pkinase Pkinase_Tyr C2-set_2 Ig_6 Receptor_2B4 RhoGEF Ig_5 Izumo-Ig Ig_C17orf99 Spectrin Kinase-like Herpes_gE Kdo CRAL_TRIO_2 RIO1 SH3_1 CRAL_TRIO DUF4660
Motif
Other DBs
NCBI-GeneID: 111338391
NCBI-ProteinID: XP_022800614
Position
Unknown
AA seq 12750 aa AA seqDB search
MASQKAMDELARQSGFEDLSFATRTYRPEYASSPDLRGSYRPQRAIRTSEMESTLRAKLA
YTSGGRDRDGRNILTIPAGKTEDLSVDRLGDTLSYLTQSPRDGRQGQMYMVIIDLRGSSW
KSAKPLLRTLQETVPEKVHEVYIIKPDAFWEKRRSGTGLRKEQSSVAFQTTLLSSSSKLH
QFAEGSQLTQELGGSLSYNHNRWIDTRLEIEQLSDPSVSLNEKFDELEEDLDTHQLGNNI
ADTDGLIRQHETKRALLDNVAYPLIQRGEHLISSIKANEPPIPPSQNFPGSPASLPSQER
QQVEGIVTQLNLRCSQLMDMWEKRWKELIQCMDLLEFDAGYQKVTDWVLGPGESYLANSN
DIGDSVISCEILRKEHEELELSAREVINHFAQVRELAKKMLQENHYASRDIKSRKEFLDR
GCRNFALRMNRRRDIILTSLKFHKSAGECSVNLDDLFELLCSDSVLMYDYESAESMLRTL
EEKAEAVSVSSEDTLRDALAVQELMTSPMSNMRGDDVTQDYEKGIAHVRLTLDELRERKL
RTDELCDVRRIKLQQLLQLKQSERDAEQATVWISQLRDATEHNLGDVGRNSEDIEALQQE
HEKLETTAKSTYDYGRQFLQASLVLRRTCRYELTPNYQMEEKLNSAWSEFSSAMAERGAR
LSVALMFRRSAEKLVQDIEGHRGRYMREDLLEDLTAEFIEEEIRRHSETRHSIDKEYAET
VAMGKTLIDRMQLPPLYGENGTPNRPPHLLEESLADLEERKMAWERVWQDRDERLRHWLK
LGDYEQQMRELLQWVKDRTSETEENKHMIGENLTEAEALSADLQGLEERLKEKEREVAEL
IQIIKSIHVASAEDQSNRPYGRMADSLEEAWNDLNVQLEGRRILLDTSVAFHHSVEKFSD
KINTSEDEISRTLLVEDVTSSSSLLHQHQELRKSVLELSMQTLSKGQALLDKLREASSHA
DINNHHATKAACYSVERILEALQHRRKQLDEQWKERKKVLEQCMKRCKIDEEIRQITKWL
NEEGEDYLSYQDYGDSAPSTQVLLDEHFKFEEVAKEKEEAGQRLARETEKLMHGNFSDIQ
ETQQKITLLLTNLQLFKERLEDRRKLLTDTLTFYKKNSRAHDKLDEIRDKITEEKLTIED
QKELYGAINAASAAQLRDGKILQEKMADGKHQPVIVRMYEELQERSTAMLVNVEPDLADK
EFEDLCGWIRNVGEDFLDSNTVMGDSVKTSQEFLYSHQELDSERQAFADQMAKAIDVSNV
QSKKDIVKVKDIQDLWMRFSSRLEYRLKLGKMYFDFHRHRQLLFGKLDELFNQLTSDEPK
ENVDASPALLVQQEQLQDAILSASGQMQRESQALLDELQKEPREECLDRGAAADCIQKFL
ATLEARVHKLGQLWNLREEQQNKNRQLSAEFVQFEKDTREVILWIKEQSDTFFPVKVDYS
SLPIDPRELEDKLQKFKDAARRTDEDVQAHLRAAEELSEAEGSYKAAIRVITDELQIAYQ
RFKTLLADYEVLLSMSATFYSSVEKLLQMMDDMTYGLQSQPLPRDINNSQLLLQDHLANY
QTVQDLYSFTTVSAQDVLSRASTSAAVSVSRDEIKGFLERSEGRHEEWRSLWEHHRDKLL
ESVRLCEFEQAISAVNLTIEEHTRELLALNRKFGVTLLDAVTLLQESDSFLESVKPADVE
VVRLVEEAGKLKQLNHHDAPAIMRQVSAMEARWQRFLSRMEDHRAMLEASIEFHQIYEQA
SVWISDSEHFLKTTQDEAKRCKTEEEVIDLLDMLEGFVKPGLNKQEARLKKLAELSAKLT
MDEPRYQAKDLMTKQKQITTKFDFMDNDLFRLAERLRERKQRGLPPKAEEITGESVEAYE
KELLETTPDSSGYEKPVRVNVLSSFVDGVLGSKRPGDQVVFEEAGPAKRPQVSVRVRSDT
PVSTETEQKIEPIIKSEIQGWFEGGKALKPVEIPEHEILVHISEDTKREPNQMDLAPWGV
EVVKKDVTVTSLGPYVNTDIEVETALHTQTFPPSSADQAQLTRKRVWKTTTRETTTSIKQ
ETRTEVEVLVPEKPEMMSNLYVFGCLPSSENLSVEVRSKKTVESTPDTVEKTSPEEINRV
EGEMKRANENICRKIEDSVASTHKPLQHTKHAELLIPQHAGSVLIFTPPDTPRRGSAPYV
DSSKLANGHSADEDQPRFESEVHLMTTPSDFNFDAVELTLPYPFVNGEGPDSDKEAKLHR
MNAITDKLIESEGKYVDDLRSLAEDYIYQLPNAPSELAENKDTIFINSEDIFFFHKVIFC
DELAKCKGNPSEVGKVFKKREHELDRYITFCVGKSDSDRFLESQPKDFFEKCENEAPSRP
IKELLDRPVERVLEYKTFLDDMLECGEKAHVDTADIEAGKEVVDRLCAEINQKTRFEIPF
APTPKEVEFCIALEDYRDDPNNICIRKEETVVVLDRVSHPGMYKVVKLLADGSRGNEIWV
PVTVLQRKKSTAEIMMPAEYTVNLKSKPGSKFPDEASERKVAEVAPVEFVSAPVAPAFTL
PLENLKAAEGQPTQLEVRVTGTPEPQVVWLKDDLPVRSGERIHTEKDGNLYSLKISEVDI
EDEGVYTCRAKNVAGSATSTADLNVESGESEGELDVNDETDSSNLAINQNQPPQSVTLTV
HGQDGTEFAPLEVQLPKPGDISASDIHLMTESRPTSRRRSIPPEFTTELTDKTIEEGDSV
EMQIFVTGTPPPEVIWYKDDQPITIYPHRRFHATRENDICSLEIKDARCSDQGNYICRAK
NSAGVVTKSCKLTVKQVTPTSPPAFVKLLKDVHIVEGSCTRFDVKVTGMPEPEVTWFKDG
EPVKQDKHLEIIHDEDTSALILMYGTLEDAGDYTCKASSEAGNAESCAHLYISPLQIPAK
FTSQLESVEVSEGELIKLKCSVVGKPDPNISWFKDQQLVNESNRVKMKVSSDNICVLNIL
KTDMDDEGIYTCAATNTAGEDITSATVTVNGDGSAPEFTKALQNTEVSDGDSVCLEVRVH
GKPTPFVEWLKDTKLLKSGPRFDTQTRGNTHTFLITNCRDDDGGTYACKARNKFGTASCE
AVLVVAEDTVPPRFTKKLYDSTADSGNTVEFSVKYIGSPEPKVKWYLDDEEVSEDDEGMD
IETEPGSSLLVLEDIAPNDSGQYKCIISNIAGKAVTSAHLKVVDEGKETVLTSIQQIVEA
VPPPAEKRPSGKAPLFMKELSTFHVTEGDAVRLEVIVDGSPRPVVQWFVESDLVEEDEHT
HVVQEGNKYALVIDGTVLDDEAEYKCVAKNSHGIVECTAELFVDEIAVKPEFLKELKPIE
VVEGHNAQFEVKIQGNPEPDIAWFRNNVLIEPSEKYGPHRTENVHKLNIHKTVLGDSGEF
ACQARNEVGFVRSVAPLIVKPGRPHGKPPTFLQKPQNTNVLVGDVVSFEVKVEGTPTPTI
NWFREEGQEIPTTGRTVSSPTGKLTVSSVTLEDQGIYKCVAVNEAGEASCQVELLVDQGN
ACQETEDISPSNNVVVEREVPLEGVLGVPKEAESPLPPQIVKGLKDLNVSEGDTARFEAH
ITSDPIPDIEWSSSGGKIEENEETLMECEGDIYKLILMDVLPDDDGEYTVTATNKFGMVS
SIGKLSVAEKIKKPSFLDALRNVDVTENTDVRLEVRVQGTEPDIDWYKNGVLIEEVTSRT
EFVENGERGTYAYLIYGAISKDQGTYRCTAVNEAGQVSCEGQLTVRENVIPPRFLQRLED
NKVVEGGDVDLEVEVSGRPRPALKWLKDGRAVVSNDRIQIDTEGRIHTLQITHCRLSDGG
KYTCTASNSGGTDNCSAKLEVEKEMHAPEFVVRPEGARIVEGSEARFEAIVSGLPEPEIE
WFKDGKLVRDSHRFDLEFDGNRSALTVKGAKQTDDGEFTCSATNQVGRVSCSIELVVDEA
VVAPEFVKKMASIELFEGDLARFNVRVSGTPQPDVKWLKNDEPLEGESRYEFLSDDNMHS
LELSNCLLSDAGTYRCIASNEAGQMSCTSELTVTEKPSPPVFTDGPSFPNFIEAGGDVVL
EVTVSGKPTPTVEWVKDDTSLKNSNHFDIKAKDDKHTLTVSSAGPADSGAYKCIAHNTSG
TSTRTFHVNIKASKPHGTAPAFTKYLESPTAIENSPVTLECEVVGSPEISIEWIKGDSRV
RQTTRVRTEFDGKNCRLILLRTELDDEADYKCVARNAFGIASTYCELLVEEDLSESHSPP
FFKKKPRNQTVSEGQHTTFSAIIGGTPAPEVDWFKDERAIEDKGRFVIKDDLDKGKFSLT
IGETFVEDAGTYKCVAFNEIGEESHEARLSVIPLGKRSEPTVEVPFEISVNAESATPSSL
FAEPKVVVTSGEQDATEDRPRRTNKELTASRETTEIDLEPPHFIALPEGLSPFEVNADED
VTLKVRVSGKPLPDVKWLKDDKPLVETNKFLWNGDTDIHTLVIRGPTPRDKGTYVCLASN
TTGTTTRSFEVNIEGYEDWVMPSFEEHTANPFIISDNGDVTMEVKVAGNPTPSVEWRKDG
QAISENGHVKLFSSEGTHRLLIKGASPEDEGNYTCTATNPAGKSTRAYALEIGGVEPEVG
RRGQVGVDETVIPPTIVKQTEQEAPVRVSEDGDVKLEVMFSGNPDAEWTKNGKVLRESSH
FQIDSEDGVQKLVIKGATQEDKGVCKCTASNNAGASWKTFTVDCEPEENVHPEQPSELER
PSFVEDDSVVPFQLTVNGDVKLAARVQGSPTPQVEWDKDDILLQNSEHIAITSKDDLHTI
LISNPSVYDKGTYTLTATNEAGVGTRAFNVEIKGAKPITSLPEITKELVEVEVLRGQPIT
LECHVFGASDAHVKWFHDNVVLTDCERLTTSFDGVVCALTIHRSTLDDEGDYLCQIENDQ
GVVSSSAEVIVDEGMALPIFKAPLKNTSMTEGENVCFDIRVIGNPEPVVEWFKDGVQLED
EGRIMIIDDVDDDQPELFSLVIEKCEPFDAGLYKCIAMNEAGKDSCSAQLLVTPPSVPHK
SPGFAEIPVDFIEGQDVTLKALTSAQLPIVTWLKDDEPVRQSTHYDIDAKQGIHTLTIRN
ASPEDSGIYKFDTKDESTSTFKLTIKGKDSSDGVAPEVTAVTTPVEVLEGSAVKLNCEIK
GKPYPEVTWLIDESPVETSERVTVDCDGVFTSLHFRSTELDDEGEYQCKVQNEIGSAICT
LELLVNEVDDLEDQSKPEFLEKLKDVSTFEGDSAVFSVKVQGLPQPDVQWCSSEREILTD
GRFATESTEDGCHTLTISNCVTKDKGRYKCVASNVFGKAVCSAGLTVKEKLIPPQFSDQD
SGTPMLIDEGGDVTLQVEVIGKPKPSIKWYKDDQPISRSSSKYKTEVQGDKQSLTIVAAI
PEDSGAYQCRATSPSGTITRNFDVNIEAKQPEGESPKFIQPLKSQEVFEGSAAKLDVRIS
GEPEPEVEWFKDEQPIEEGGNFRIEFDDADGCALVINSAKSNYEGLYKCVASNSFGKAIS
EAELLVTGDDEDEVEPPESLVTVELSLPVSSVPFGPAEVALPVKEENLPSSYKEKREVSE
KEFPQNRPSFEAVQLVLPGQGDVPLIPDTISALEYEPVQLSVPGADEPILPDFIDVPNDL
KVNEGARVVLKVRVIGQPVPEVTWFVDDEPVQPSDKISIRSDGDKYELIIHEAEVDDEGM
YKCVAKSEAGKAICEVELLVEEAREPKTEESLEVQITKELQDVEVDEGEPAALEICFVSL
VKPTVSWSKGMKPVEPNKRVKIITDEQSSKLVIKKTVGEDEGLYKCSVKSGTWELNSSAE
LIVEEPSDDEKVILRKPVLVQKFSDEDIVEGDKLELQIKVIGSKPITVTWYRDDEKIEPD
DRCKLLSDDEIHLLRVNQVEIDDEAIYKCVVKNPAGQDQCEAQILVQEKSDAVECVDTGS
SDKAPQFISRLPEEIEVLEGDSTRLECRIGLEAEVSWFKDDEPLEEDDRITIKNESHVCA
VVISCTELDDEGYYKCVAQNEFGKTVCQTELIVEEGVSMPLIKEPLKNLDASEGDVVKFE
VRITGNPEPVVEWFKNGSQLQDEGRVIIVDDADDNDEELFCLVIEDCEVGDSGTYKVVAM
SEAGTANCECSLNVTRTQVPAEFKDEMEEVPMEGSQGDNVSMVVNTGRLPSPVIAWFKDE
EPIMSNSQLEISQDPEHSKLMVLHVTPADSGTYKCVATSVIGTITKKFLLNIEGSEPTVE
QTVSTSDVQARPVRDIAAPVFIKNMDDVVVNAGEEARFDVRVSGVPEPQVVWHWESIEVK
DKGRFVHIDAIEEDLFTLVIEGSESGDAGNYKCVASNKAGQTSCEAKLIVLEKEVEEKSL
YDKVEDKPRGEAPNFSQPLQTVEVIEGSEATLMCMVAGSPEPNIAWFKDGVTVADVKRYK
TRYDGEQATLEIQNAELDDEGEYKCVAENDLGSASCSAELLVNEPNAKPEFEEKMKPVDV
TEGEPAKFSVKVAGNPPPVIDWFKGKEKLEDEGRIKIIDDEDSDTYTLRINDTLIEDAGT
YKCIAMNEEGQVSCKAALAVKEAITKPEIDVEPEAAPLNIGEGDVVCLSAIVKGKPVPTV
VWYKDDEKLRETSRVKIDAKDSEHSLVILEAKPKDSGVYKCQAKSKGGKVEKTYDVNIKA
APPEGIAPVFIESLLPVEVVQGSPAKLQCRVTGTPEPTIEWFRDSEPLTEDKRVKIRFDG
ELCTLKILETELEDEGAYKCFAKNEFGSVSCASELLVNEPYKKPEFTQKLKPINVIEGEA
ARFDATVEGNPIPVVDWFHGKNKLEDDGRFVVMDDEEAGIYTLIIEDTVLEDAGTYKCIA
ANEEGQASCKAALAVKEQMITPEFTNEEQSAPFNVMEGDEVRLMVGIKGKPAPTVEWYKD
DKKLRKTSRVRMDEKDGKFSLVISDVTSEDRGTYKCEASSKAGTVTRTFDVNVAEKSLEG
KAPEVVEPSKSVQVLEGFPAKLECQISGQPKPEVEWLRDNEKVKECERAQFLSDNETFSL
NFKETKLDDEGDYKCVAQNAFGSVSCWAELLVNKPAAKPEFKERMKNVSVQAGQQARFDV
LITGVPRPQVDWTKDGKILEEPAERFTFLDDEYEEDEGRSSLIIEDVKLEDAGKYECLAY
NEEGEVFCEANIFVQETLTALAFVDEVESAPIFAEEGGDVSLSAELRKSEPELKVEWLKD
DKKVKEDEHLHVSVREDTHMLKITEVVPEDSGLYKFKATSKAGSVEREFDVQVSARKPEG
SAPQFTEPLLPIEVKEGDTTKLHCKATAEPPPTFEWLKNGVRVKESGRIKLDSDGMASSL
SFKDARPDDKGEYKCVASNALGSASCTAALKVRVLSKPDFKEKLKRVEVVEGDFASFDAV
VVGYPEPFVEWXRGTARLQNDECTEIKEDQENGHFSLTIKDVNRDDAGMYKCVAYNEAGK
TTIRGELSVKERLFAPEFPEGQEEAPVTVIEGDDCKLNVTIIGKPKPDVKWYKADKPLRQ
STRLGIKASGDKHSAVILGIRADDSGVYKCEAKSKMGTATRTFDVMVQAKKPKGIAPEIA
KPLQDLTVVEGKPANLECEVKGEPQPNIEWFRDGEPVKQSKRINLNFDGNFASLSFRLAE
LDDEGEYKCVARNELGSASSEAELLVEEAETKPNFKEKLKNISVLPGAEARFDVRVVGVP
PPEVDWFKGKQKIEDEGRFILIDDEEHDLFSLVIEEARPTDSGEYECVAFNEVGEVSCQS
NLVVEETTIAPEDAEQAESALPAIDEAITVPDSAAEVESALVTGQEIDGVKAKKPEGKAP
VFFETLQPVEVKEGNDAKLQCTVTAKPKPNIEWFKKGVQIKENRRVKLENDGESIALTIK
EARSFDEGEYKCVATNEIDSASCAATLKVRVVTKPEFKDKLKTVEVTEGDAVQFDARVDG
YPVPAVQWFKGISKLKSDGRIEFKENPDENLFSLEICDTLLEDAGMYKCEASNQGGKTTC
RADLIVKERLFAPEISGDQPEAPFTATEGGEVSLDVLINGKPKPDVKWYKDDKPLRESIR
LDIRARGDKHSVVILGARADDSGVYKCEAKSKMGTATRTFDVMVQAGKPKGSAPVFTFPL
QSVEVSEETKVKLSCTLTGTPQPIIRWLKDGEPLETSKRVKADFDGDVASLSFRAAEIDD
EGDYKCIAQNELGTASCSAELLVNEADRKPEFTEVMKDIEVAENEEGRFDVRLTGSPKPA
VQWLKETDKIEDAGKYILIDDEEDNLFSLVIDDVSPDEAGTYTCKATNNVGVAACKAELK
LKENMAAPEFADEEETGPITAVEGGEVTLSVTVRGKPRPDVEWLKDDKPLRKTSRLDIKS
RDDKFSLVVRNVSPENSGLYKCVASSKAGRVTRTFQVNIEGKKAKKPKGEAPQVTQPLKA
MQTVEGNPLRLKVRMIGTPEPTAEWCKNGEQVELSQRIKADIIGDMCQLSFAETQEADSG
SYKCIVTNDLGSAFSEAELVVTKPIVAPVFKEKLKGLQVNEGEQVQLDVRVSGNPKPNVL
WFRGSQAIINEGRYIVKVDDGDELYSLIIDETTLEDSGIYKCVASNEVGKATCRGELEVN
ERLTPPEFAGEFSDAPVIFKEGEEVSLEITIRGKPAPDVEWYKDELSLRKSSNMTTLVKG
EKHTLLLNSAKPADSGVYKCVAKSKLGTAMRTFNVTVEAKKPKGSAPEFFKPLKKVEVVE
GSGAKLECWVHGKPEPSIEWYKDDELITSSIRVNTYFDSEVCRLTISDTVAEDEGKYKCV
ATNDLGKVSCSAELLVNKAIIMPEFKEKMKHTDVIEGDTARFDVRVVGNPKPVTEWSKGG
KVIANGGRFKIEQSEDSEVHSIFIENVSLDDFGSYKCVASNEAGRMQCSARLDVKERQIA
PEFSDEGGDSPIKVKEGDELKINVTIRGNPRPDVEWFRDDRPFKRTSRGNISVRGNKYGI
RIFTVTPEDSGVYKCVAKSAAGTTTKTFQVDIEGKKPAPRFTQPLEETQATIGSTARLKC
RLNATAKPNIEWTKNGQPVSENRRVKTGLEGDLISLVISDARPEDSGDYQCVVKNKSGTA
SCSTRLVVSESTNKPEFKKLMNDLELLEGEDAVFEIAVSAKPDPVVQWFLRKMPINNEGK
YTIFEDSERRKFSLTVSDCSTEDSGQYRCLVTNSAGEVTSSAELKVNNRQVAPRFVQGAE
EQLFEVWEGAPVKLLVQARGKPTPQVEWFKENRLARRVKRVELQTEGDMNILLIPKAVPD
DSGNYRAEATNSVGTAVKPFVVIVNAQKLVLRREPVPEGAVKPEFIQRLQDIEIVEGSAA
KFDVRVKGTPEPEVDWYKDNRVIREGGRIRFLFEDDGLCSLLIREAESSDRGRYKCVASN
PAGKVQCSAELFIESHGFDSASGSDYERRLSRESTFDMLSDDTEDEVESSSTSGPAKLPP
DITLVLRNRDVKEGGVTKFACRVVSSTGVTAEWYKDDQLVSKWPRFTCERDEDLYALNIS
DAKRTDAGHIRFVARNDFGQVESNAYLNVEPDMEPEFEGTTPRFTQKLKDIDAVPGKTAS
LECRVIGDPRPDIRWYRENEPLLEGGRYKFEDDDDRQVLVIDDVCGSDEGMYKCVARNSA
GKAHCTADLYILQTDDEESVSAGEQEPEEEIRKQRVSTEASPVIETLLSPDSAQVEKSEP
PLPTATKPRSKPESPKPKERLREPEFILKLRDKSAVEGSSVRLACRAMGTPEPGFQWYKD
GEPIGGGGRFDINQSVSGFTLVIKECQVEDSGEYQCEATNKVGSVSSSAEVTITTLSKPR
QELTVRPEFERNFTDTKVIEGEEAKLTAKVSGNPVPDVIWQKEGKPIGEGRRVKIEKSKD
GVHSLRIQRAEADDEGEYKCVAKNKTGEAWCSAKLTVEVPKPEIKEGVMSLPKKPVDEQI
VVMATDVPLSREPKLEGSALATPPQFSRTMQTAEVIEGSAARFDVKVTGSPGPEIRWLKD
DKLLEENRKIRFDEDDDGVFSLFVNDVVTDDEGMYKCEATNVKGEVSCTAELIIEGLEES
TGGESEETSEDELQSKDGPRTTETPKPADRKVAPPTAPKPKSVMKSVPKPVFLLELQDKQ
VKEGDNLTLDVRVPLECKAEVTWYKDDHALKEDHHITIISAGEMQAVNIFNMSVKDEAVY
RCVAANDAGSVSTDCEVLVEEKVKVPQTVMNRGRLSQMAPEFVQECTDICVVKNSTAQLE
IIAAGSQPLQIRWFKDNEPIKYGKRLKMSSDGEHCSLKISPVEIQDQGIYKCVISNKAGT
QSCEAKLAVEELVDFKESTDGTAPGFPVTKRPSRSKSGAKPTILSPLGDIEVNDGENVTL
EVTSGPEPIDNIEWFKDNDLIRSQPRFTQSSAGEQHTLDIQSVTVDDEGIYKCVLLNNWG
IASCSAEVLVEESMSESSSQDDEQLVKLNARMERRRSRDSVCEPEFQQELSNNDVFVGDT
VYFTVKSRGIPEPEVSWYRNGDLVKEDSRVKFIKDSQTGNYSILINKVAVEDEGEYRCVA
SNMGGSVACQAKLSVKALGQREAPSFTAPLTDRSIEDSSAARFDVRVRGKPTPTVTWFKD
GKKISGEQFPHIKVLQERDLFSILITEGKFEDAGMYKVVAKNDLGEVSSTGVLFVEGADQ
LSPFAGEKPPRKNSGLSRVEEVLTLKLYTAIEDFYSEETGNKFLKKCDKVEVLDTSRPEF
WLVRRVSRGSEIGFVRHTCLKRDEDGDETTDIPMRGEKQKFVCITNYPAQASDEVSVNEG
DMLEILDDVGLESSMVCVIPTGAVGWLPRVFIIRAPEEDVKKAPKTAKGKEREALIQREF
VLNELIESERKYVNDLRTVVESHLAELDAADIPDEVVEHEDAVFSNIKEIYGFHARQFLH
ELEACAKSPDDLPKVILRHKTKFEMYIKFLEGRPLANEKLESEETQGFWTEFQEDTKDAM
SLTEYLKKPAQHLDEYVLLLKELLKFTVRANLQHSDFQAALEFLASLSRRANEATQKSYI
EGYNGEVPLESLGRLIRQEVVLFWEEKARGKGKERDLFLFEKGIVNTKRKEGGRKFIFKN
VLKLTSGNVGLTEHVEGGARQFMVWVGTSITTALVLHTFETKTEWSKQVWVREIKRLLHL
SEKSLITAVAPSLMFGELEVQLPSASSTEGNLVTTVKETITSPSYSHLIAELEKQYVAIT
PPDSPEPQRLNIQLGGTYHLSEETLERDTHERVIGRGEQVRVLRSGRDLYFVQTVKDRET
KEGWVPGSWLLERGFEDQIAGAQIQLELEAGLEDDIPQDLSSEASEPELQRLKETGEAQP
KFTEELEDIEVCVGQPASLRCRVEGDPFPDIEWFVDDDKIKKGGRFDFLSNGDLVTLKIS
ETSAEDEGEYKCTATNENGMASTSAELIVNAPAKIDKAPKSQTVSVGDVVSFKCEISGNP
IPTGTWYKGKKELKDEGRVLIEIAEDFSELEIENVETSDEGEYTCLVKNDFGEDTCSVTL
TVKGGGDVNENNVDKGGDEAVAKDDDGDGESDVESKDLDLPLRDPVFLRTDKKFDDTYVS
QKELGKGKFGVVKKVKEKSTGTEYAAKFLKITKESREEVLAEMLIMNELHSKRLIYLHDA
YERPKEMIIVLELISGGELFEKVCNDDNLTEKEVVRYMKQILQGVEHMHRKRIVHLDLKP
ENVLCVIRPDGKEDLKLIDFGMARVLEPGKSVKVACGTPEFVAPEVISYEAISLASDMWS
VGVIAYVLLSGLSPFMGDDDNETIQNVSTAEWDFEDEAFDVVSDMSKKFIEELLIRGPEK
RNDVFKCMNHDWLKKVKTLKAQKLSTENLKKFIARRRWARTANALRALSRMGSLGGLMAG
GGKPGGAAAAPKTGGFLKKVKEEKAKEEVQEKGAKAEPKKEPVKKEVPKEEPKKISPGDS
LVPERRGLSYSGRRSPALSGRRSPMSRAEAHGMPLGPPVFIQHLTNCEIIENSAARFECK
VSGNPEPEVEWYKDGKLLKESKQLTFLYDDNDNCKLIITKGTAADAGEYTVVAKNPHGKV
SSSARLLIDTGSTDDETASDSELSEPSGSEAEERTMTPKEEKITKYYTVQDELGKGRFGV
VCKCIDNKTGRAYAAKFIKCTAPKDRQDVIHEAEIMSSVRHRRLLRLQDFFQTPTEMILV
MDLVTGGELFEKVVEDEFISEIEVSHYMKQILEGVQHLHQREVLHLDLKPENIMLIRPES
KQIKLIDFGLARKYNPKENLKVMFGTPEFVAPEVITYERITPATDLWSIGVIAYILLSGL
SPFMGDTDAETLTNVQLAEWDFDDPVFDDISDEAKDFISGLLVLKANKRSTVDQLLKHRW
FTIKKDKGKKLKTDRLKAFTARRKWRRAITAIRSTNFLSRILGSRGSDDKKSSGGGGGGL
LARVKAMHAAGIQGSEGGVPPASSPFLSPASAAFSTSNSFTSVTVTERTQTQGETTVTEK
ETVTVTKDGQTTVEEKETTTRIGETTQQENKTEEVDNGKTGGLGGAANTPQAIAKRYSTG
GVALKLENVDKFWGIKHEIAKGRFSVIKRCLDAKTKKPFVAKIIKYDDDTDREDTLQEFD
IHRSIKGDKVVMLRDAFLVRRYLVLVMDMLEGQDILSFVGSKPRPSEEDICFVIRPLLDV
VNYLHGQQIVHLDIRPANIFIAKSNLGVKLIDYGSARRIKNWKEGDMLAIVSYVAFTAPE
LLDFAPVSGPADMWSIGVLIYALISGMLPFSVETKDDEDEDEKLGEAIKRGKWSFDSKAF
QRNTSEVKDLITSLLSKDAKKRPTAEEAAKHPWLMGDNMQKRRSSDVVSSKLKDLSQKLL
LKDKEDVVSASCVLKTFNEDPYGSPDSDEE
NT seq 38253 nt NT seq  +upstreamnt  +downstreamnt
atggcttctcagaaagccatggacgaattggctcgacagtcaggttttgaggatttgtcg
tttgctacaaggacatatcgtccggaatatgcttcctctccagacctacgaggatcatac
agacctcagcgcgcgattcgaacttctgaaatggaatctacgcttagagccaaacttgct
tacacttcaggggggcgcgatcgggacggccgaaatattttgactataccagccggaaaa
actgaagatttgagcgtagatcggcttggagatacactttcctacttaacgcaatcacca
agggatggaagacaaggacagatgtacatggttatcattgaccttaggggctcatcctgg
aaatctgcaaaacctctacttagaactcttcaggaaacggttccagaaaaggtgcatgaa
gtctatattattaagcctgatgctttctgggagaaacggcgctcaggaactggtctcaga
aaggaacaatctagtgttgcatttcagacgacattgttgtcatcatcaagtaaacttcat
cagtttgccgaaggaagtcaactcacccaagagctgggtggttctttatcatataaccac
aacagatggattgatactagattggaaattgagcaactttcagatccgtcagtctctttg
aatgaaaaatttgatgaattggaagaagacctagacacccatcagctaggaaacaacata
gcagatacagatggcctgattcgtcaacatgaaacaaagagggcactgttggataatgtt
gcctatcctcttatccaaagaggggaacacctcatcagctcaattaaagctaatgaacct
cctataccaccaagccagaatttccctggcagtcctgcttctttaccaagccaagagcgt
cagcaggtggaaggtattgtgactcaactaaacctgagatgcagccagttgatggacatg
tgggaaaagagatggaaagagttgatacagtgtatggatctactggagtttgatgcagga
tatcaaaaggtgactgactgggtccttgggccaggagagtcatatttagccaattccaat
gatattggagattctgttatctcctgtgagattctgaggaaagagcatgaggaattagag
ctgtctgccagggaagtgataaaccacttcgctcaggtgcgtgaacttgccaagaaaatg
ctccaggaaaatcactatgcctccagagatattaagagtcgcaaggaattcctagacaga
ggttgtcgtaactttgccttgcggatgaacagaaggagagatatcatactcacatcactt
aaatttcacaaaagtgccggagagtgctcagttaatttggatgacttatttgaactgctg
tgttcggattctgttcttatgtacgactatgagtccgcagagagcatgctcagaacactg
gaagagaaggctgaggccgtttccgtttcgtctgaggacaccttgcgagatgcattggct
gttcaagaattgatgacaagcccaatgtccaatatgcggggtgatgacgtcactcaggat
tatgaaaagggcattgcgcatgtgcggctcactttggacgaactaagagagcggaaactt
cgcacagacgagttgtgtgatgtgcgcagaatcaaactgcagcaactgttgcagctcaaa
cagagcgaacgagatgctgagcaggcaactgtgtggataagtcaactgcgtgacgcaacg
gagcataacctgggagatgtgggaaggaactctgaggatatcgaggctctgcaacaggaa
catgagaagcttgaaactacagctaaaagtacatatgattatggtcgacaatttctccag
gcctcattagttctccgtcgcacgtgtcgctatgaactgaccccaaactatcaaatggag
gaaaagttaaacagcgcttggagtgaattttcatcggctatggctgaacgaggagcgaga
ctctctgtggcgctcatgtttcgtcggagcgcggagaagcttgtccaagatattgagggg
cacagaggaagatacatgagagaggacctcctggaagacctcacagctgagttcatcgag
gaagaaattcgccgacactctgaaacaagacactctatcgacaaagaatacgctgagacg
gttgccatggggaaaaccttgattgacagaatgcaattacctccactgtatggagagaac
gggacaccaaatcggcctcctcatctcttagaggaatctctggccgacttggaggagaga
aaaatggcctgggaaagagtgtggcaagacagggacgagcgactccgccattggttgaaa
ctcggagactatgaacaacagatgcgagagcttcttcagtgggttaaagacagaaccagc
gaaacagaagagaacaaacacatgattggtgaaaacctgaccgaagctgaagcgcttagt
gctgacctacagggactggaagaaagactcaaggaaaaagaaagagaagttgctgagctc
attcagattatcaagtcaatacatgtagcttcagcagaagatcaaagtaacagaccctat
ggaaggatggcagattctctagaagaggcctggaatgaccttaatgttcaattagaggga
aggaggatacttcttgacacctcagttgcttttcatcacagtgtagagaagttttctgat
aaaatcaatacctcagaagatgaaatcagccgaactcttttagtggaagatgtgacatca
tcatcatcattgcttcatcaacatcaggaactaagaaaaagtgtattggaattatccatg
cagactttatctaaaggacaagctctcttggacaaattacgagaggctagttcacatgct
gacataaacaaccatcatgccacaaaagcagcatgttacagtgtggaacgtattctggaa
gccctgcaacacaggcgaaagcaacttgatgaacagtggaaagagcgaaaaaaagttttg
gagcagtgtatgaaaagatgcaagattgatgaagaaataagacagatcacaaaatggcta
aatgaggaaggagaggattatcttagctatcaagactatggagactcggcaccctcaact
caagttctcctcgatgaacacttcaaatttgaggaagtggcaaaggaaaaggaagaggct
ggccagaggcttgcacgagaaacagaaaagcttatgcatggaaacttcagtgacatacag
gaaacacagcaaaaaattaccctgctactaacaaacctgcagttattcaaagaacgtttg
gaagatagaaggaaactactgacagatacactaaccttttacaagaaaaacagcagagca
catgataagcttgatgaaataagagacaaaattacagaagaaaagctgaccattgaagat
caaaaggagctgtatggagcaatcaatgcagcatctgcagctcaactgcgagacggaaag
atattgcaagagaaaatggcagatgggaaacaccaacctgtgattgtgagaatgtatgaa
gaattgcaggagagaagtacagctatgcttgttaatgttgaacctgatcttgctgacaag
gaatttgaagatctctgtggttggattaggaatgttggtgaagactttcttgatagcaac
acagtaatgggtgattctgtcaaaacatcacaggaatttctgtattcacatcaagaactg
gattctgagagacaggcttttgcagatcaaatggccaaagcgattgatgtgtcgaatgtg
caatcaaaaaaagatattgtaaaagtgaaagatatacaagatttgtggatgaggttttct
tctcgacttgaatacaggcttaagctggggaaaatgtactttgatttccatcgccataga
caactgctgtttgggaaattggatgagctcttcaatcagctgacaagtgatgagcctaaa
gagaatgttgatgcatcacctgcattacttgtacagcaagaacaactgcaggatgccatt
ctttcagcctctggacaaatgcagagagagtcacaagcacttcttgatgagttgcaaaaa
gaacccagagaggagtgtttggacagaggggcagctgctgattgcatacagaagttcctg
gcaactctagaggcaagggttcacaagcttggccagctttggaacctaagagaagaacaa
caaaacaagaacagacagctgagtgctgagtttgtgcagtttgaaaaagacaccagggag
gtcatactatggattaaagaacagagtgatacatttttccctgtcaaagtagactacagt
tcccttcccattgacccaagagagttagaagacaagttgcaaaagttcaaagatgctgca
aggcgcactgatgaagatgttcaagcacatctacgtgcagcagaggagctgtcagaggca
gagggtagctacaaagcagccatcagagtcattacagatgaacttcagattgcttatcaa
aggtttaagacactgctagcagattatgaggttttgctgtcaatgtcagcaacattttac
tcaagcgttgaaaaacttctccaaatgatggatgatatgacatatggccttcaaagccaa
cccctccccagagacatcaacaactcccagctccttctacaggaccatctcgccaactac
cagacagttcaagacctgtacagcttcaccactgttagtgcacaggatgtcttaagccgt
gcttccacttcagcagctgtctctgtatctcgtgatgaaatcaagggcttccttgagaga
tcagaaggaagacatgaggagtggaggtctctttgggaacaccatagggacaaattgtta
gaaagtgtgcgattgtgtgaatttgagcaggctatcagtgcagtcaacttgaccatagag
gagcacaccagagaactgcttgctctaaacagaaagtttggagtcactctacttgatgct
gttactttgcttcaagagtcagattcatttctggagtctgttaagccagctgatgtggaa
gtagtaagactggttgaagaagcagggaagttgaagcaattaaatcatcacgatgcacct
gccattatgcgacaagtttctgcaatggaagcccgctggcagagatttttgtccaggatg
gaagaccacagggccatgcttgaagcatcaatagagttccatcagatttatgaacaggca
tcagtatggatcagtgatagtgagcacttcttgaaaaccacccaggatgaagcaaaaagg
tgcaagacagaggaggaagtcatagaccttctagacatgttggaagggtttgtgaagcct
gggcttaataagcaagaggcacgactgaagaagttggctgaactttcagctaagcttact
atggatgaacctcgctaccaagcaaaggatcttatgaccaaacagaagcagataaccact
aagtttgatttcatggataatgaccttttccgtttagcagagagactcagagagagaaag
cagcgaggacttcctcccaaggcagaagaaataacaggagaaagtgtagaggcttacgag
aaagaattgctggagaccactcctgactcatcaggctatgaaaaaccagtgcgtgtaaat
gtgttgtcatcatttgttgatggagtcttgggcagcaaaagacctggtgaccaggtagta
tttgaagaggccggaccagccaagcgtccgcaggtctcagtgcgagtgaggtcagacaca
ccagttagtacagaaactgagcaaaagatagagcctatcatcaagtcagagatccagggt
tggtttgaaggtggaaaagctctgaagccagtggaaatcccagaacatgagattctggtt
cacatcagtgaagatacgaagcgagaacctaatcagatggatctagctccttggggtgta
gaagtggtaaagaaagatgttacagtgacctccttagggccttatgtcaacacagacatt
gaagttgaaacagccctccacacacaaacatttccaccatcttcagcagaccaagctcag
cttacgagaaaacgtgtatggaaaacaacaacaagggagactactacaagtataaaacaa
gagacaagaactgaagtagaggtgctggttccagaaaaaccagaaatgatgtcaaatctc
tatgtatttggttgtttgccaagctctgagaatctgagcgttgaagtgcggtccaagaaa
actgtggaaagtacaccagacaccgtggaaaagaccagcccagaggaaataaacagggtg
gaaggagagatgaaaagagctaacgagaacatctgtaggaaaattgaagattccgtagca
agtacccacaaaccattgcagcatactaaacatgctgagcttctcatacctcagcatgct
ggttcagttctgatcttcacaccaccagacaccccaagaagagggtcagctccttacgtt
gattcaagcaagctagcaaatggccactcagctgacgaagatcaaccaaggtttgagtct
gaagtgcatctcatgaccacacccagtgacttcaactttgatgctgtagagttaactctt
ccgtacccctttgtgaatggggaaggccctgactcagataaagaggccaagctgcatagg
atgaatgccatcactgataagttaattgaaagtgagggcaaatatgtggatgacttgagg
tcgcttgcagaggactacatctatcaacttcccaacgcaccatctgaattggctgagaat
aaggacaccatttttatcaactcagaagatatcttcttcttccacaaagtgatcttttgt
gacgagttggcaaagtgcaaaggaaatccgtcagaggttggcaaagtgttcaagaagagg
gaacatgaacttgacagatatataaccttttgtgttggaaagagtgactcagacaggttt
ttggaatcacagccaaaagattttttcgagaaatgtgaaaatgaagcgccttctcgtccc
ataaaggaactcttagatcggccagttgaacgtgttctggaatataaaacctttcttgat
gatatgttggagtgtggggaaaaggctcatgtggatacagctgacattgaggctggtaaa
gaagtagttgatcgtctttgtgctgaaattaatcaaaagactcggtttgagatccccttc
gctcctactcccaaagaagttgagttctgtatagcattagaagactacagagatgaccct
aacaacatttgcatccgcaaagaagagactgtggtggttttggatcgggtgtcacatcct
ggaatgtacaaagtagtcaaacttcttgcagatggttcccgaggcaatgaaatttgggtt
ccagtgacagtccttcagcggaagaagtctacagcagaaatcatgatgcctgcagaatac
accgtgaatctcaagtccaagcccggatctaaatttccagatgaggcttcggaaaggaaa
gttgcagaagtggcaccggtagagttcgtatcagctccagttgctccagcatttaccttg
cccttggaaaatcttaaggcagctgagggccagccaacacagctggaggttcgcgttact
ggtactccagagcctcaagtggtatggcttaaagacgaccttcccgtcagatctggagag
cgcatccataccgagaaggatggcaatttgtacagcttaaaaatttctgaagttgatatt
gaggatgagggagtctatacatgccgcgccaaaaacgtagcaggatcagcaacttccacg
gcagacctaaatgttgaatccggtgaatcagagggcgaacttgacgtgaatgatgaaact
gacagctctaatttagcaataaatcaaaatcaaccaccccagtcagtgacattaactgtt
catgggcaagatggaactgaatttgcaccccttgaggttcaacttcccaaacccggtgat
ataagtgcttctgacatccatttgatgacagagagtaggccaacatctcgtcgaaggtct
attccccctgaattcaccacagaactaacagacaaaacaattgaggaaggggactctgta
gaaatgcagatctttgtaactggcacacctccacctgaagtgatttggtacaaagatgat
caaccaatcacaatttatcctcacaggcgcttccatgcaaccagagaaaatgacatctgt
agcctagaaatcaaggatgcgagatgcagtgatcaaggaaactatatatgccgagctaag
aacagtgctggtgtagtcacaaaatcctgtaaactaaccgtgaagcaagtcactccaaca
agccctcctgcttttgttaaacttttaaaggatgtgcatattgtggaaggctcttgcact
cgtttcgatgtgaaagttacaggaatgccagagcctgaggtaacctggtttaaagacgga
gagccggttaaacaagacaagcatttggaaattattcacgatgaagacacatctgctttg
attcttatgtatggtacactagaagacgcaggtgactatacttgtaaagccagtagcgag
gctgggaatgctgaatcatgtgcgcatttatacatatcacctttacaaatacctgccaaa
tttacgtcacagctagaaagtgtcgaggtgtctgagggagaactaatcaagcttaagtgc
tcagtggttggaaaaccagatcccaatataagttggttcaaggaccaacaattagttaac
gaaagtaatagggtaaaaatgaaagtatcatctgacaacatctgcgtattaaacattctc
aagacggacatggatgacgaaggaatttacacatgcgctgcaacaaatactgctggagag
gacatcacctctgccacagtgacagtaaatggtgatgggagtgctccggagtttaccaaa
gctctgcaaaatactgaagtatcagacggtgattcagtttgtttggaagttagggttcat
gggaaaccaacaccatttgtagaatggcttaaggacacgaagcttttaaaatctgggccg
cgctttgatacccaaacaagaggaaatacacatacatttctaattacaaattgtagagat
gacgatggtggtacttatgcatgcaaagcaaggaacaagttcgggacagcctcttgtgaa
gcagtgctggttgttgcagaggatactgtaccaccaagatttacgaagaaactctatgac
tctacagcagattctggtaacaccgttgaattttctgtcaagtacattggtagtccagag
ccaaaagtcaagtggtatttggatgatgaggaggtttctgaagacgacgaaggtatggac
attgagacagaaccaggttcatctttgctagtacttgaagacatagcaccaaatgactct
ggacagtacaaatgcatcatatctaatatagcaggcaaagcagtgacaagtgcacacctg
aaagtggttgatgaaggtaaagaaacagtcctaactagcattcaacagattgtggaggct
gtgcctcccccggcagaaaaaaggcccagtggtaaagcgcctctcttcatgaaggaactg
tcaacttttcatgtcactgagggagatgcagtccgattggaagtaatagttgatggctca
cctagaccagttgtgcagtggtttgttgaaagtgaccttgtagaagaagatgagcataca
catgtagtccaagagggaaataagtatgccttggttatcgatggaacagtattggacgac
gaggctgagtacaagtgtgttgccaagaattctcacggaatagtagaatgtacagctgaa
ctttttgtggatgagatagctgtcaaacctgaatttcttaaagaactaaagcctatcgaa
gttgtggagggtcacaatgcacaatttgaagtgaagattcaagggaatccggaaccagac
attgcatggtttagaaacaatgttcttattgaacctagtgaaaaatacggaccacataga
actgaaaacgtccacaaactgaatattcataaaactgttcttggtgattcaggagaattc
gcgtgtcaagcaaggaatgaagttggttttgttcggagtgttgcacccctcattgttaaa
ccaggaagacctcacgggaaacccccaaccttcttgcagaaacctcaaaatacaaatgtt
ttggtgggcgacgttgtttccttcgaggtgaaagttgaaggaacgccaacgcccaccatt
aactggtttcgtgaagagggtcaagagattcccacaactggtcgtactgtttcctcgcca
actggtaaattgacagtcagttctgtgactcttgaagaccaaggaatctataaatgtgtt
gctgtcaatgaagctggagaagcgtcatgtcaagtggagcttttggttgatcaaggaaat
gcttgccaagaaactgaagatatatcaccatcaaataatgtggttgtggaacgtgaagta
ccccttgaaggtgtgctcggggttccaaaggaggcagaatcgccattaccaccacaaatc
gtgaaagggttaaaagatcttaatgtatcagagggagatacagcacgttttgaagcgcac
attacgagcgaccctatacctgatattgagtggtccagcagtggtgggaaaatagaagaa
aacgaggaaacccttatggaatgtgaaggtgacatttacaaacttattttgatggatgtt
cttccagacgatgatggagagtatacagtcacagccacaaacaaatttggaatggtgtca
tctatcgggaaactctctgtcgcagagaagataaaaaagccctctttcttggacgcactg
agaaatgttgacgtaactgaaaatactgatgtgcgtctggaagttcgtgtgcaaggtacg
gaacctgatattgattggtacaagaatggcgttttgatcgaggaagtaacgtcaagaact
gaatttgttgagaatggagagagaggaacttatgcttatctcatctatggtgccatatca
aaggatcagggcacctatcgttgtacggcggtaaatgaggcgggccaagtgtcgtgcgaa
ggacagctgacggtgagagaaaacgtcattcctcctaggtttctccagcgcctcgaagac
aacaaagttgttgagggaggtgatgttgacttggaggttgaagtcagtgggagacccaga
ccagctttgaagtggctgaaagatgggagagctgttgtttcaaatgatcgtattcaaata
gacaccgagggccgcattcatacattgcaaataactcactgcaggctttcagatggaggg
aaatacacctgtactgcttctaatagtggaggcactgataattgctctgctaaactggaa
gtcgagaaggagatgcacgccccagaatttgttgtccgacctgaaggagcacgcattgtc
gagggaagtgaggccagatttgaggcaattgtttctggtctaccagaacccgaaattgag
tggtttaaagatggaaaacttgtacgagacagccaccgctttgatctggagttcgacgga
aatcgatctgctcttactgtgaaaggagcaaaacaaacggacgatggagagttcacgtgc
tcagctaccaaccaggtggggagggtttcttgttctatcgaacttgttgttgacgaggca
gttgttgctcctgaatttgtcaagaaaatggcgagtattgagttatttgaaggtgacttg
gcacgatttaacgttcgagtgtctggcacgcctcagccagatgtgaaatggctgaagaat
gacgagcctttggagggggaatcacggtatgaatttctctccgatgataacatgcattcc
ttggagttgtctaattgcttattatctgatgctggaacataccgctgtatcgcttcaaat
gaagcaggacaaatgtcctgtactagtgagctcactgttacagaaaaaccatcccctcca
gtgtttacagatgggccctcttttccaaatttcattgaagctggaggtgacgttgtgcta
gaggtaacggtgagtggcaagcctacaccaaccgtagagtgggtcaaagatgatacatct
ctaaagaacagcaaccattttgacatcaaagctaaagatgataaacatacattgactgtt
tccagtgctggccctgctgattctggagcttataagtgcatcgcacataatacttcagga
acgtccacaaggacttttcacgtcaatattaaagcctcaaagccgcatggaactgcaccc
gcgtttacaaaatatttggagtcaccaactgccattgagaactctccagtaactttggaa
tgcgaagttgttggttctcctgaaatatccatcgagtggattaaaggcgattctcgagtt
aggcagacgacacgtgttcgtaccgaattcgatgggaaaaactgccgcttaatcttgtta
cgcacagagctagatgatgaagcagattacaagtgtgttgccagaaatgcgtttggcatt
gcatcaacatattgcgaactgctagtggaggaagatctcagtgaaagtcatagtcctcct
tttttcaaaaagaagccacgcaatcaaactgtatcagaaggtcaacatacaacgtttagt
gctattatcggaggaactccagcacctgaagttgattggtttaaagatgaaagggcaatt
gaagataaagggagatttgttataaaagacgatctcgacaaggggaagttttccctaact
attggggagacttttgttgaggatgctggcacatacaagtgtgtcgcttttaatgaaatt
ggagaggagtcacacgaggcaagactaagtgttattccactcggaaagagaagtgaaccc
accgttgaggtgccttttgaaatctcagttaatgcagagtcagccacaccttcgagctta
ttcgcggagccaaaggttgtagtaacatcgggagaacaagatgcaaccgaggatagacct
cgacgcacgaacaaggagcttacagcttcaagagagaccacagaaattgatcttgaacct
cctcacttcattgccttgccggaaggtctcagtccttttgaagtgaatgcagatgaagat
gtcactctgaaagtgagagtgagtggtaaacctctcccggacgtaaagtggctgaaagat
gacaagcccctggtggaaactaacaagttcctatggaacggtgatactgatatacatacg
ttagtgatccgtggacccacgccaagagataaaggaacttatgtctgtctagcatcaaat
actactggaactaccacgagaagttttgaagtgaacatagaaggctatgaagactgggtt
atgccttcatttgaagaacatacagcaaacccctttataatatcagataatggcgatgtg
accatggaagttaaagtagcgggaaaccccacaccaagcgttgagtggagaaaagacggt
caagccatttcggagaatggacatgttaaattattttcatcagaaggcacccacagactt
ttaatcaaaggagcttcgccagaagacgaagggaattacacgtgcacggcaactaacccc
gctggaaagtcgaccagagcatacgctctagagattggtggtgtggagcctgaagtaggc
agaagaggccaggtaggtgtagacgaaacagtaatacctccaacaattgtgaaacagaca
gagcaagaggcaccagtaagggtttcggaggatggtgatgttaaattggaggttatgttt
agtggaaatccagacgcagagtggacaaagaatggaaaagtcttacgggaaagtagccat
tttcagatcgactcagaagatggagtgcagaagcttgttattaaaggtgccactcaggag
gacaaaggtgtatgcaaatgcacggcttctaataacgctggcgcctcgtggaaaactttt
acagttgattgtgaaccggaggagaacgttcatccagaacaaccatcggaactggaaagg
ccttcctttgttgaagatgacagtgttgttccatttcaactgactgtcaatggagatgtt
aagcttgcagcaagagttcagggtagtcccacaccacaagttgagtgggataaggatgat
attcttctacaaaacagcgagcatattgctattacttcaaaagatgaccttcacaccata
ctgatttccaatccaagtgtttatgacaaaggaacgtacactcttactgctacaaatgaa
gctggagttggtacacgtgctttcaatgttgagattaaaggtgcaaagccaatcacttcg
ttgccagaaatcaccaaagaactcgtcgaggtagaggtacttcgaggacaaccaatcaca
ttggagtgtcatgtctttggagcttctgacgctcacgtgaagtggtttcatgacaatgtt
gttctgactgactgtgagcgattaaccacctcgttcgatggtgtagtttgtgccttgaca
atccatcgctcaactctagatgatgaaggggactatctttgtcagatagagaatgaccaa
ggtgtcgtgtcaagctctgctgaagtgattgtggacgaaggaatggcattaccaattttt
aaagcgccgctgaaaaacacaagtatgacagaaggcgaaaatgtttgctttgatatccgt
gttattggaaatccagaaccagtcgtggaatggtttaaagatggtgtgcagcttgaagat
gagggccgtattatgataattgatgatgtggatgatgatcagccagaactcttctcgctt
gtaattgaaaagtgtgaaccattcgatgccggtctgtacaaatgtatagctatgaacgaa
gctggcaaagattcgtgtagtgctcaacttttagtcacccctccatcagttccacacaaa
agtccaggttttgctgagattccagtggatttcatagagggccaagatgtaacactgaag
gctttgaccagcgcccaacttcccatagttacttggcttaaggatgatgaacctgtgaga
cagagtacccactatgatattgatgctaaacaaggcatccatactctaacaataagaaat
gcctccccagaggactctggaatttacaagtttgataccaaagatgagagcaccagcacc
ttcaagctcaccattaaaggaaaagattcttcagatggcgtcgcaccggaggtcacagca
gttaccactcctgtggaagtactggaaggaagtgcagtcaaactaaactgtgagatcaaa
ggaaaaccatatccagaagttacttggctgatagatgagagccctgtcgagacaagcgag
cgtgtcaccgttgattgtgatggagtgtttacctcacttcactttcgaagcactgagcta
gatgacgaaggagagtatcagtgcaaagtacagaacgagattggatcagcaatctgtact
ttggaacttctagttaatgaagtcgatgatcttgaagatcagagtaaaccagaattttta
gagaagttgaaagatgtcagcacatttgaaggtgatagtgctgtcttcagcgtaaaggtt
caaggccttccgcaacctgacgttcagtggtgctcgtctgaacgggagattttaacagat
gggcgatttgctacagagtctaccgaagatggttgccacacgcttactattagtaactgt
gtgactaaagacaaaggaagatacaaatgtgttgcatccaacgtatttggaaaggctgtg
tgttcggctgggttgacagttaaggaaaagttaatccctccccaattttcagaccaagac
agtggaactccgatgttgattgatgaaggaggcgatgttacactgcaagttgaagtaatt
gggaagccaaagccctccattaagtggtacaaagacgaccaaccaattagtcgaagcagt
agcaagtacaagactgaggtgcaaggagataagcagtctctgactattgtcgctgcaata
ccagaagactccggggcgtaccagtgtagagctaccagcccgtctgggacaataacaaga
aacttcgatgttaatatagaagcaaaacaacctgagggtgagtctcccaagttcatccag
cccttgaagtcccaggaagtgtttgaaggtagtgccgcaaagcttgacgtccgcatatca
ggtgagccagagcccgaagttgagtggtttaaagatgaacaaccaatagaagaaggtggc
aacttcagaattgaatttgacgacgctgatggctgtgcgctcgtcatcaattctgctaag
tcgaattatgaaggtctgtacaagtgcgtggcttcaaattcatttggtaaagcaatctct
gaggcagagttactagttacaggagacgatgaagatgaagtggagcctccagaaagctta
gtaacagtggaactaagtttaccagtaagttcagtaccgtttggacctgcagaggttgca
ctgcctgttaaagaggagaaccttccttcatcttacaaggagaaacgtgaagtgtcagag
aaagagtttccacaaaatagaccttcatttgaggctgttcagcttgttttacctggacaa
ggagatgttcctctgatacctgacactatttcagccttggaatacgagccagtccaactg
agcgtgccaggtgcggatgaacctattctgcctgactttattgatgttcctaatgactta
aaggtaaatgaaggtgccagagtggtcctcaaggtcagggtgattgggcagcctgtgcct
gaagttacgtggtttgtagatgacgagccagtacaaccaagtgacaagatttctattcgt
tctgatggagataaatatgagcttattatacatgaggcagaggtggatgatgaaggaatg
tacaaatgtgtggcaaaaagtgaggcagggaaagctatctgtgaagtggaattgctcgta
gaagaagcaagagaaccaaaaacagaggaatcccttgaagttcaaatcacaaaggaactg
caagatgtcgaagttgatgaaggagaaccagcggctttggagatttgttttgtgagtcta
gtcaaaccaactgtgtcatggtccaagggaatgaagcctgtagaaccgaacaagagagtc
aaaattataacagatgaacaaagcagtaagctggttattaaaaagaccgtcggtgaagat
gagggactttacaagtgttcagttaagagtgggacttgggaactgaattcttctgctgaa
ctaatagttgaagaaccaagtgacgatgagaaagtgatactcagaaagcctgttctggtt
caaaaattttctgatgaggacattgtggagggagacaagcttgaactgcaaatcaaagtg
attggctccaaacctatcacagtcacgtggtacagagacgacgaaaagatagaaccagac
gatcgctgcaaattactctcagacgacgagattcatctgctcagagtgaaccaagttgaa
attgacgacgaggccatatacaagtgtgtagtgaagaatcctgcaggacaagatcagtgt
gaggcacaaatcctggttcaagaaaagagtgatgctgtggaatgtgtagatacaggatct
agtgacaaagctcctcagtttatctcacgtttaccagaggagattgaggttcttgagggt
gactcaacacggcttgagtgtcgaataggactagaggcagaagtttcctggttcaaagat
gacgaacctttggaggaggacgatcgcatcaccattaaaaacgagagtcatgtttgtgca
gttgtcatctcctgcacagaattagacgatgaaggatactacaaatgtgttgcgcaaaac
gagtttggcaaaactgtgtgtcagactgagctgatagtggaggaaggtgttagtatgcca
ctgattaaggaaccgctgaagaaccttgatgccagtgagggtgatgtggttaaatttgag
gttcgcatcacaggtaaccctgaaccagtagtggaatggttcaagaatgggagtcagttg
caagacgagggacgtgtgatcattgttgacgatgctgatgacaatgacgaagagctgttt
tgtctggtaatcgaggattgtgaagttggtgattctgggacttacaaggtcgtggcaatg
agtgaggctggaactgccaattgtgagtgtagcctgaatgttactcgtactcaggtccca
gcagagttcaaagatgaaatggaagaggtgcctatggaaggctctcaaggggacaatgtg
tctatggttgtcaataccggccggctgccctcaccagttattgcatggttcaaggacgaa
gagccaatcatgtctaattctcaacttgagatctcacaggaccctgagcactctaagcta
atggttcttcacgtgaccccagcagactcgggtacatacaagtgtgttgcaaccagtgta
atagggacaattaccaaaaagtttcttcttaatatagaaggatcagaacctacagtagaa
cagacagtaagtacttccgacgtgcaagcaagacctgtaagagatattgccgcaccagtg
tttataaagaatatggatgatgttgtagttaatgctggggaagaggcccgatttgatgtt
agagtttctggcgttccagaaccccaagttgtgtggcactgggagtcaattgaggttaaa
gataaaggacgatttgtgcacattgatgccattgaagaagatctgttcacattggttatt
gaaggcagcgaatcaggagatgctggtaactacaagtgcgttgcttccaacaaggctggt
caaacgtcatgtgaagctaagttgattgtgcttgaaaaggaagtggaggaaaaatctctt
tatgacaaagttgaagataaaccacgaggagaagcccctaacttctcacagccattgcag
acagttgaggtcatagaaggaagtgaagccactctgatgtgcatggtcgcaggtagtcca
gagcctaacatagcttggttcaaagatggcgtcactgtggcagacgtgaaaagatacaaa
actcgatatgatggagagcaagccactttagaaatccagaatgcagaattggatgacgaa
ggtgaatacaagtgcgtggctgaaaacgaccttggctcagcctcctgttccgctgaactc
cttgttaacgaaccaaacgctaaacctgagtttgaagaaaaaatgaagccggttgatgtc
actgaaggagaacctgcaaaattttctgttaaagtggctggtaatccccctcctgttata
gactggtttaaaggaaaggaaaaattggaggacgaagggcgaattaaaatcattgacgac
gaagacagtgatacttacacacttagaatcaatgacacgctcatagaggatgctgggaca
tacaaatgtatagctatgaatgaggaaggccaggtatcatgtaaagctgccttggcagtg
aaggaagccatcactaagcctgaaatagatgttgaaccagaagctgctccattgaacata
ggagagggtgatgttgtttgtcttagtgcgatcgtgaaagggaagcctgttcccacagtc
gtctggtacaaggatgacgagaaactgcgtgaaacaagccgtgtgaagatagatgccaaa
gatagcgaacactctcttgttattctggaggccaaaccaaaggactctggggtatataag
tgtcaggcaaagagcaagggtggtaaagtggaaaaaacgtatgatgtcaacataaaagcc
gcgccgccagaaggtattgcaccagtgttcatagagtccctactgccagtagaggtagtg
caagggtcacccgctaagctacagtgtagagtgactggcacaccagaaccaactatcgag
tggttcagagacagcgaaccgctgacggaagacaagagggtcaagatccgttttgatggc
gaattgtgtactttgaagatcttagaaactgaacttgaggatgagggcgcttacaaatgc
tttgccaagaatgaatttggatctgtttcctgcgcgtcggaacttttagttaacgaaccg
tacaagaaaccagagtttacacaaaaattgaagcccattaatgtcattgaaggagaagca
gcacggtttgatgccactgtggaaggaaatccaattccagtggtggattggttccatggc
aaaaacaaactggaagacgatggtcgtttcgtcgtgatggatgacgaagaggcaggcatc
tacacattgatcatcgaggacactgttcttgaagatgcaggaacatacaaatgcatagct
gctaacgaggagggacaggcaagttgtaaagctgctcttgccgtcaaagaacaaatgata
acaccagagttcacgaatgaagaacaaagtgctccatttaacgttatggaaggagatgag
gtacgcttaatggtaggtattaaagggaagcctgcgccaactgtggagtggtacaaagat
gacaaaaagttgagaaaaaccagccgagtaaggatggacgaaaaggatggcaagttctct
ttggtaatttcagatgttacttccgaagacaggggaacctacaaatgtgaagcttcaagc
aaggcaggcactgtaactcgtacatttgatgttaatgtggcagaaaagagcctggaagga
aaagcacccgaagttgtggaaccttcaaaatctgttcaggttcttgaaggtttccctgcc
aagttagaatgtcaaataagcggacagcccaagccagaggtagagtggcttagagacaac
gaaaaggtgaaggagtgcgagcgcgcacagtttttaagcgataatgaaaccttctctttg
aatttcaaagagactaaacttgatgatgaaggtgactacaaatgtgttgctcagaatgcg
tttggcagtgtgtcttgctgggctgaacttcttgtaaacaaaccagctgcaaaaccggag
ttcaaagagagaatgaagaatgtcagtgttcaggctgggcagcaagccaggtttgatgtg
cttattactggagtacccaggccacaagttgattggacgaaagacggtaagatattggaa
gaaccagcggagcgatttacttttttggatgatgaatatgaggaagacgaagggcgctcc
tcactgatcattgaggacgtaaaactagaagatgctggaaaatacgaatgtttggcatat
aatgaagaaggtgaggtattctgtgaggccaacatttttgtgcaagagaccctgactgcc
cttgcgtttgttgacgaagttgaaagtgccccaattttcgctgaagagggaggtgacgtc
agtttgagtgcagagctgagaaaaagcgaaccagaactgaaagtcgaatggctgaaagat
gacaaaaaagtcaaagaggatgagcatttgcatgtttctgtcagagaggacacgcatatg
ctgaaaattacggaagttgtcccagaagattctggattgtacaagtttaaggccactagc
aaggcaggctctgtggagagggagtttgatgtacaagtttcagccaggaagccagaaggc
agtgcaccacaatttacagagcccttactaccaatagaagtgaaagagggcgatacaact
aagcttcattgtaaagcaaccgctgaaccacctccgacctttgagtggcttaaaaatgga
gttcgagtgaaagagagcggaagaatcaagctggatagtgatgggatggcatcctctctc
tcttttaaagatgcgaggccagatgacaaaggagagtacaaatgtgttgcctcaaatgca
ctcggttctgcttcgtgcacagcagcgttgaaagtgagggttctatctaaaccagacttt
aaagagaaattgaaaagggttgaagtagttgagggtgattttgccagctttgatgctgtt
gtcgtcggttatcctgaaccgtttgtggagtggtagagagggacggctaggctccagaat
gacgagtgcactgaaataaaagaagatcaggaaaatgggcatttttctcttaccattaag
gatgtcaatcgtgatgatgctggaatgtataaatgtgtcgcttacaatgaagctggaaag
accacaatacgtggtgagctctctgtgaaggagaggctgtttgctcctgaatttcctgaa
ggacaggaagaggccccagttacagttatagaaggcgatgactgtaaattgaatgtaaca
atcattgggaagccgaaacctgatgtgaaatggtacaaagccgacaaaccccttcgccag
agtacaaggctaggcattaaagcaagtggagataaacattctgcggtgattctcggcatc
agggcggatgactctggtgtttataagtgtgaagccaagagtaagatgggaactgccacc
agaacgtttgatgtaatggtacaagctaagaaaccgaaaggaatagcaccagaaatcgcc
aaacccctccaagaccttacagttgtggaaggtaaaccagcaaacttggagtgtgaggta
aaaggagaaccgcaacccaacattgaatggtttagagatggcgagccggtaaaacaatcg
aagcgcatcaacttgaactttgatggcaattttgcttctttatcgttcagactagctgag
cttgacgatgagggcgaatacaaatgcgtggctcgtaatgagctcggtagtgcatcaagc
gaagcagagcttctagtggaagaagctgaaaccaaaccaaattttaaagaaaagctgaag
aatatcagtgtcttgcctggggccgaagcaaggtttgatgtgcgtgttgtgggtgtaccg
ccaccagaggttgactggtttaagggaaaacaaaagatagaagatgagggtcgttttatt
ttgattgatgacgaagaacacgacctgttttctctggtgattgaagaggcaaggccaact
gacagcggtgaatatgagtgtgttgcattcaatgaagtcggtgaagtgtcatgccaaagt
aacttggttgttgaagaaacgacgatcgcaccagaagatgctgagcaagctgaaagtgcg
ctgcctgcgattgatgaagccatcactgtacccgactcagctgccgaggttgagagcgct
cttgtcactggacaggaaatagacggtgtgaaagctaagaaaccggaaggaaaagcaccg
gtattttttgaaactcttcaacctgtggaagtaaaggaaggaaacgatgccaaactacag
tgtactgtgactgctaaacccaaacctaacatcgagtggtttaaaaagggagtgcagata
aaagaaaacagacgggtcaagttagaaaatgatggggagtccattgctttaacaatcaag
gaagccagatcttttgatgaaggagaatacaagtgcgtggctaccaatgagattgactca
gcatcttgtgcggccactctaaaagttcgtgtcgtaactaagccagaattcaaggataaa
cttaaaacagtcgaagtgaccgaaggagacgctgtccaattcgatgctcgagtagatggt
taccctgtgcctgcggtgcagtggtttaaagggataagtaagctgaagagcgatggtcga
attgagtttaaagagaatcctgatgagaatctgttttcacttgaaatctgtgatactctg
cttgaggatgctggaatgtacaagtgtgaagcctcaaaccaagggggtaaaaccacatgc
cgagctgacctcattgtgaaggagaggcttttcgcccctgaaatttcaggagaccaacct
gaggcccccttcactgcgactgaaggtggagaagtaagtttggatgtcttaatcaacgga
aaaccaaaacctgatgtgaaatggtacaaagacgacaaaccccttcgcgagagcataagg
ctagatatcagagctcgaggagataaacactccgtggtgattctcggcgctagggcggat
gactctggtgtttacaagtgtgaagctaagagcaagatgggaactgccaccagaactttt
gatgttatggtacaagctgggaagccaaaaggaagtgccccagtgtttacctttcctttg
caatcagttgaagtctctgaagaaacaaaagtaaaactttcctgtacactgacggggact
ccacaacctatcatccggtggcttaaagatggagaaccactagagaccagtaaacgagtt
aaagctgactttgacggagacgttgcgtctttgtcatttcgcgcagcagaaattgacgat
gaaggtgattacaaatgtattgctcaaaatgagctgggtactgcatcctgttctgcagaa
cttctcgtaaacgaagctgataggaaaccagaatttaccgaagttatgaaggacattgaa
gtggcagaaaacgaagaaggaaggtttgatgtgcgtttgacaggatctcccaaaccagct
gtacaatggcttaaagaaactgacaagattgaagatgctggaaaatatattttgattgac
gatgaggaagataatctcttctctcttgtaattgatgatgtttccccagatgaggccggt
acttacacctgcaaagcaacaaataacgttggagtggccgcctgcaaagctgaacttaaa
ctaaaggagaatatggcggctcctgaatttgctgacgaggaggagacaggcccaatcact
gcagttgaaggtggcgaggtgacattatctgttaccgttagaggcaagcctcgccctgat
gtcgagtggctcaaagatgacaagccattgagaaagacaagtcgtttagacataaaatcc
cgagacgacaaattttctttagttgttaggaatgtctcaccagagaactctggcctatac
aagtgtgtagctagtagcaaggccggacgcgttaccagaactttccaagtaaatatcgaa
ggtaaaaaagcaaagaaacctaaaggagaggcaccacaggttacgcagcccttaaaagca
atgcagactgtagagggaaatcctttaagactgaaagttcgtatgattggtacaccagaa
cccacggctgaatggtgcaaaaatggagagcaggtcgaacttagtcaaaggatcaaagct
gatattataggcgatatgtgtcaattgtccttcgctgaaacacaagaagctgatagtgga
tcttacaaatgtattgttacaaatgatctgggatcggctttttctgaagcagaacttgtc
gtcaccaaacctatagtagcgcctgtatttaaggaaaagctaaaaggtttacaagtgaat
gaaggtgaacaagttcagcttgatgtacgggtcagcggaaatcctaagccgaatgtttta
tggttccgtggatctcaagctatcattaacgaaggacgatatattgttaaagtagacgac
ggggatgaattgtattctctcataattgatgaaacaactttggaggacagtggtatttac
aaatgtgttgcgtctaacgaggtaggaaaagccacatgtcgtggggaattagaagttaat
gaaagacttacgcctccagaatttgcaggcgagttcagtgatgcccctgtgatcttcaaa
gaaggtgaagaagtttcgttggaaattacaatacgaggaaaacctgctcctgatgttgag
tggtataaagatgaacttagtctcagaaagtcatcgaatatgaccactctggtgaaagga
gagaaacacacacttcttctaaacagcgctaagcctgctgattctggggtgtacaagtgc
gtagcgaagagtaaattgggaacagcaatgcggacttttaacgtcaccgtagaagccaaa
aaacccaaaggctcagcgccggagtttttcaagcctctaaagaaagtagaagttgtagaa
ggcagtggtgctaagttagagtgctgggttcatggaaaaccagaaccaagcattgaatgg
tataaagacgatgaacttatcacatcaagtatacgagtgaacacctacttcgattctgaa
gtttgcagattgacaatttctgatactgttgctgaagacgaagggaaatataaatgtgta
gcaacaaatgatcttggcaaagtgtcttgctccgcagagcttcttgtcaataaagctatt
ataatgccagagtttaaagagaaaatgaagcacactgacgttatcgagggtgatacggcg
cgatttgacgtccgcgtggttggcaatcctaagcctgttactgaatggtcaaagggtgga
aaagttatcgccaatgggggaagatttaaaattgagcaatccgaggacagcgaggtacac
tccatatttattgagaatgtgtcattagatgactttggaagctacaaatgcgttgcgtcg
aacgaggctggaagaatgcaatgttctgcacgacttgacgtaaaagagagacagattgcg
ccggagttctccgatgaaggcggcgattcaccgataaaagtaaaggagggcgatgaactt
aagataaacgtgaccattcgaggcaatccaaggccagacgtagagtggtttagagatgac
aggccatttaaaagaactagtcgcggcaacatatcagtgcgaggaaacaaatatggtata
agaatcttcactgttactcccgaagactctggagtgtataaatgcgtggcgaagagtgct
gcaggtacaacgactaagaccttccaggttgatattgaagggaagaaacctgcacccagg
ttcactcaaccgttagaagaaactcaagctaccattggaagcacagcgagactaaaatgt
cgccttaatgccactgctaaacccaatattgagtggacaaagaatggtcagcctgtaagt
gaaaaccgacgggttaaaacagggttggagggtgacctcatctcacttgtcatctcggac
gccaggccagaagatagcggagattaccagtgtgttgttaagaacaaaagtggaactgcg
tcgtgtagtacgcgtcttgttgtaagcgaatcgacgaataaaccggagttcaaaaaactg
atgaatgatctggaattactagaaggagaggacgccgtttttgagattgcagttagtgca
aagcccgaccccgtagtgcagtggttcttgagaaaaatgccgataaacaatgaaggaaag
tacaccatcttcgaagattcagagcgtcggaagttttcactcactgtaagcgattgcagc
acagaggacagtggtcagtataggtgccttgtaacaaatagcgcaggtgaagtcacgagt
tcagctgagctcaaagtcaataacagacaagtcgcacctagatttgttcaaggcgcagag
gagcagctgtttgaggtttgggaaggtgctccagttaagcttttggtgcaagccagaggg
aagcccacccctcaggtagaatggttcaaggagaatcgccttgctcggagagtcaagcgg
gttgagctgcagacagaaggtgacatgaacattctgttgattcctaaagcagtcccagat
gattcagggaattatcgagctgaagccacaaactccgttggaacagctgtcaaaccgttt
gttgttatagttaatgctcaaaagcttgtcctccgacgagaaccagttcctgagggagct
gttaaaccagagttcattcagcgacttcaggacatagagatcgtggagggaagtgctgcc
aagtttgacgtccgtgtcaaagggacaccagagccggaggtagattggtacaaggataat
cgtgtgattcgtgaaggcggtcgaatcagattcttgtttgaagacgacggtttgtgttca
ttgctcataagagaagctgaatcatctgacagagggcgatacaagtgcgtggcgagtaat
ccagccggcaaggttcagtgcagtgcagaactcttcatagaaagccatggttttgattct
gccagtggctctgactacgagagacgtctttcacgtgagtcaacatttgatatgctgtcg
gacgacacagaagatgaagttgaatcatcctccacaagtggtccagccaagcttcctcca
gatataacgcttgtgttacgcaaccgtgacgtgaaggaaggtggcgtgacaaagtttgct
tgtcgtgtggtcagcagtactggcgtgaccgctgagtggtacaaagatgatcaacttgtc
agtaaatggcctcgcttcacttgtgaacgtgatgaggatctttatgctttgaatatctca
gacgctaagaggacagatgcgggacacattcgatttgtggcacggaatgattttggtcag
gttgagagcaatgcatacctcaatgttgaacctgacatggagcctgaattcgaaggaact
acaccaaggtttactcagaaactcaaagatattgatgcagttcccggtaaaacagctagt
ctggagtgtcgtgtgatcggcgacccgcggccggatatccgttggtacagagagaacgaa
cccctgctcgagggagggaggtacaagttcgaggatgatgatgacagacaagtgcttgtc
atagatgacgtatgcggaagtgatgaaggcatgtacaagtgcgtggcaaggaacagcgcc
ggcaaggcacactgcaccgcggatttgtatatattacaaacagatgacgaagagagcgta
tcagcaggtgaacaagaaccagaagaagagatacgaaaacaacgtgtttctacggaagca
tcaccagtgattgagaccctcctatcacctgattcagctcaggtagagaagtcagaacca
cccctaccaacagcaacaaagcctcgatccaaaccggaatctccaaaaccaaaagaacgt
cttcgagaaccagagtttattctaaagcttagagataaatcagcggttgaaggtagctca
gttcgcttggcatgtcgggccatgggaacaccggaacctggtttccagtggtacaaggat
ggcgaaccaattggcggaggaggacggtttgacatcaaccaatcagtgagcggatttacg
cttgtgatcaaagaatgtcaggtggaagactcgggagaatatcaatgtgaagccacaaac
aaagtgggcagcgtcagttcgtcagctgaagtcactattacaacactctccaaacctcgt
caagaattaacggttcgtccagaattcgaacggaatttcactgacacaaaagtcattgag
ggggaggaggcgaaactgacagctaaggtgtcgggtaatccagtcccagatgttatatgg
cagaaggaaggcaagccaatcggagaaggccgtcgagttaagattgagaagagcaaagat
ggggtgcattcacttcgtatacaacgtgcagaggctgatgatgagggagagtacaagtgc
gtagcgaagaacaagacaggcgaggcttggtgttctgctaagcttactgttgaagttcct
aagccagaaatcaaggagggtgtcatgtcacttcctaagaagccagtcgacgagcaaatt
gtagtaatggccacagacgtcccactgtcacgtgaacctaagcttgaaggtagtgctctt
gcgactcctccccagttttctcgaacaatgcagacagcagaagttatagaaggaagcgcg
gcgcgatttgatgtcaaggtcactggaagccctggtccagaaatacggtggctgaaggat
gacaaactgcttgaggagaaccgaaaaatccggtttgatgaggatgacgacggagtgttc
tctctgtttgttaatgatgtggttactgacgatgagggcatgtacaagtgtgaagcaaca
aatgtcaaaggagaagtgtcttgcactgcagagctaataatagaaggccttgaagaatca
acaggaggtgaaagtgaggaaacttcggaagatgagttacaatctaaggacggacctcga
acaacggagacgccgaaacctgctgacaggaaggtggcgcccccaactgcaccaaaacca
aagtctgtaatgaaatcagttccaaaaccagttttcttgttagagcttcaagacaaacag
gttaaagaaggtgacaatctgacgctagacgttcgagttcccctcgagtgcaaggccgag
gtcacgtggtacaaagacgaccatgctttgaaagaggaccatcatattactattatctcc
gctggtgagatgcaagcagttaacatcttcaatatgtcagtcaaagatgaggcagtgtac
cgttgtgttgctgccaatgatgcgggatcagtgtctactgattgtgaagtgcttgttgaa
gagaaagtcaaagttccacagacagtaatgaaccgcggtcgcctttcccaaatggccccc
gaatttgtccaagaatgtaccgacatctgtgtggtaaagaattccactgcacagttagaa
ataatagccgctggcagccaaccactgcagattcgctggtttaaagacaacgagccgatc
aagtatggaaagcggttgaagatgtcgtctgatggagaacactgttcgctgaagatttcc
cctgttgagattcaggatcaagggatttacaagtgtgttatatctaacaaggctggaaca
cagtcctgtgaggcgaagttagctgtggaagaattagtagattttaaagaaagtaccgat
ggcacagccccaggcttcccagtgacaaaacggccatccaggtcaaagagtggtgctaaa
ccgacaatcctctcccctctgggggatatcgaggttaacgatggtgaaaatgtcactttg
gaggtgacttccggtcctgagcccattgacaacatcgagtggttcaaagacaatgacctg
atccgctctcagcctcgattcactcaatcatcagcgggcgagcaacacaccttggacatt
cagtcagtcactgtcgatgacgaaggaatttataaatgcgtgctgctcaataactggggc
attgcttcgtgttcggctgaagtcctagtggaagagtcaatgtcagaatcttcatcccaa
gatgacgaacaacttgtaaagttaaacgcccgaatggaacgtcgaagatcacgtgacagc
gtctgcgagccagaattccaacaagagcttagcaacaacgatgtctttgtcggggacact
gtatactttactgtcaagtcgagaggcataccggaaccggaagtctcatggtacaggaat
ggagatcttgtgaaggaagactcaagagtgaagtttatcaaagattcgcagactggaaac
tattccattctcatcaacaaagtggccgtggaggacgagggcgagtatcgttgtgtggct
tccaacatggggggatctgttgcctgtcaagcaaaactttcggtcaaagcgcttggacaa
cgtgaagcgccttcattcacagcgccgctaaccgatcgctccatcgaagatagcagtgca
gctaggtttgatgtgcgcgtgcgtggaaagcctaccccgacagtcacttggttcaaagac
ggcaaaaagatcagtggtgaacagtttccgcacatcaaagttttgcaggagagagacttg
ttctctattctgataacagaaggcaagtttgaagatgctggaatgtataaagttgttgcc
aaaaatgatctgggagaagtgtcctctactggagtgctatttgttgaaggagccgatcaa
ttgtcaccctttgctggagaaaaacctccgcgtaagaactcaggcctgtcaagagttgaa
gaggttctcacgctcaaactatacacggcaattgaggacttctactcagaagagactgga
aacaaattccttaagaagtgcgacaaagtcgaagtactagataccagcagacctgagttc
tggttggtcagacgggtgtcacgtgggtcagagattggatttgtacgtcacacatgcctg
aagagagacgaagatggggatgaaaccacagacataccaatgagaggagagaaacagaag
tttgtgtgtatcaccaactacccggcccaggcctctgatgaggtctcggtaaatgaggga
gacatgttagagatccttgatgacgtaggcttggagagctcgatggtctgcgttattccc
actggcgctgtcgggtggttaccgagggtctttatcataagggcccctgaggaagatgtg
aagaaggccccaaagactgctaaagggaaagagagggaggcgctcattcagcgagaattc
gtgctaaacgaactgatagaatctgaaaggaagtacgtcaacgacctccgaactgttgtt
gagagtcatttagctgaacttgatgcagcagatattcccgacgaagttgttgaacatgag
gatgctgtgttttccaatatcaaggaaatatacggatttcacgcaagacaattcctgcac
gaactggaggcttgtgcaaagagtccagatgacttaccaaaggttattttgagacacaaa
acaaaatttgaaatgtacatcaagttccttgagggaagaccgttggcaaatgaaaagttg
gagagtgaggaaacacaagggttttggacggagttccaggaagacacaaaagatgctatg
tccctcacagagtaccttaaaaaaccagcacagcaccttgatgaatacgtcctgcttctt
aaggaattgctcaagttcactgtacgtgccaatctgcagcactcagattttcaggcggct
cttgaattcctagctagtctatcccgacgagcaaatgaagcgacacaaaaatcctacatc
gagggatacaatggtgaggttccacttgaaagtctcgggagactcatccgccaggaggtg
gtgctattctgggaagagaaagctcgaggaaaaggaaaagagcgggacttgttcttgttc
gagaaaggaattgtaaacacgaaaagaaaagaaggaggaagaaagttcatctttaaaaac
gtgctgaagctgacaagtggtaatgttggtctgactgaacatgttgaaggtggtgcccgt
cagttcatggtgtgggtgggtacttccatcaccactgctctggtactccatacctttgag
acaaagaccgagtggtccaaacaggtctgggttcgagaaattaaaaggctattacatctg
agtgaaaaatcactaattactgctgttgcaccatctctgatgtttggtgaacttgaagtt
cagttaccgagtgcttcatctacagagggaaatctggtgactacagtcaaagaaactatc
accagtccttcttactcgcatttgattgctgagcttgaaaaacagtacgtggccatcaca
ccaccagactcgcctgaacctcaacgtctgaacattcaactaggaggcacctatcacttg
tccgaagaaacactggaaagagatacacatgagcgggtaatcggccgcggtgaacaagta
cgggtgctccgctcaggccgagatctctacttcgtgcaaacggtcaaagacagagaaacc
aaagagggctgggttcctggaagctggttgctagaaagaggatttgaagaccagattgcg
ggtgctcaaattcagctagagctggaagctggtttagaggatgatattccacaagatttg
agttcagaagcgtccgaaccggagctgcaacggctcaaagaaactggagaagctcagccg
aagtttacagaggaacttgaagacatcgaagtttgtgtcggccaacctgccagtctgcgc
tgtcgagtggaaggagatcctttcccagacatagaatggtttgtagatgatgacaaaatc
aagaaagggggaagatttgactttctcagtaacggagaccttgttactctgaaaatttcc
gaaacaagtgccgaagacgaaggagaatacaaatgcacagccacgaatgaaaacggaatg
gcttccacaagtgctgagctcatagtaaatgctccagcgaaaatcgacaaagctcccaag
tctcaaacggtcagtgtcggggatgtggtttctttcaagtgtgaaatttctggaaatccc
atcccgactggaacttggtacaaaggcaaaaaagagctgaaggatgagggaagagtgctt
attgaaatcgcagaggacttctccgagctagaaattgaaaatgttgaaacctccgacgaa
ggagaatacacctgcctggtgaaaaacgactttggagaggacacgtgctcagtgactctt
actgtgaaaggcgggggagatgtcaatgaaaacaatgtcgataaaggtggtgatgaagct
gtagccaaagacgatgacggtgatggtgagagtgacgtagaaagcaaggaccttgacctt
ccgcttcgagatccagtcttcctgcggacggataagaaatttgacgatacttacgtgtct
cagaaagagctcggaaagggcaaatttggtgttgtcaaaaaagttaaagaaaaaagcact
gggacggaatacgccgccaagttcctaaaaatcaccaaggaatcaagagaagaagttctg
gcagaaatgcttatcatgaatgaactgcacagtaaacggctcatctacctccatgatgca
tacgagagaccaaaagagatgattatagtcttggaactgatctctggaggcgagctgttc
gagaaagtctgtaatgatgataacttaaccgagaaagaagttgtgcggtacatgaagcaa
atactgcagggcgttgaacatatgcacaggaaacgtattgtccatttggatcttaagcct
gaaaatgtactttgtgtcattcgccctgatggtaaggaagatcttaagttgattgacttc
ggaatggctcgtgtacttgaaccaggaaaaagcgtcaaagtggcctgtggtacgcccgaa
tttgtagcacccgaagtgatcagttacgaagctatcagccttgctagtgacatgtggagt
gtgggcgtcatagcttatgttctgctgagtggtctgtcacccttcatgggagacgatgac
aatgagaccatacagaacgtgtccactgctgagtgggattttgaagacgaggcttttgat
gtcgtgtcagacatgtccaagaagtttattgaggaactgctcatcagaggtcccgagaag
agaaatgatgttttcaaatgtatgaaccatgattggttgaagaaagtcaaaacactcaag
gctcagaagctcagtacggaaaacttgaagaaatttattgcacgccgtcgttgggcgaga
acagcgaatgctttgcgagctctgagtcgaatgggatctctaggtgggctgatggctgga
ggaggcaaacctggtggcgcagctgctgcccctaaaacgggtggctttctaaagaaggta
aaagaagagaaggccaaggaggaagttcaggagaaaggagccaaagcggagccgaagaag
gagccagtcaagaaggaggtacctaaggaggaaccgaagaaaatttcaccaggtgatagc
ctcgtaccagaaagacggggcctgagttattcaggtcgccgaagtcccgccttgagtggc
aggagaagcccgatgtctcgggcagaagcccatggcatgccactaggtccccctgtcttc
attcaacacctgacgaattgcgagatcatagagaacagcgccgccagatttgaatgcaag
gttagcggtaaccctgaaccggaagtggaatggtataaagacgggaagctactgaaggaa
agtaaacagctcacattcctatacgatgacaacgacaactgtaaacttatcatcactaag
ggaactgcagccgacgcaggcgaatacacggtagtagccaagaatcctcacggtaaagta
tcgagtagcgcacgattgctaatcgacacgggttcaacggacgatgaaaccgcgagcgac
tccgaactctctgaaccgtctggctctgaagctgaggagagaacaatgactccaaaagag
gaaaagattacgaagtactacactgttcaagatgagctcggcaaaggtcgctttggtgtt
gtgtgcaagtgcattgacaataaaactggccgcgcctatgcagccaagttcatcaaatgt
actgcgcccaaggacagacaagacgtcatacacgaagcagagatcatgagttctgttcgg
cacaggcggcttcttcggcttcaagatttcttccagacacccacggagatgatacttgtc
atggatctcgtcacgggtggagagctgtttgagaaggtggtagaagatgagttcatctcg
gagatagaagtgtcgcattacatgaaacagatattggaaggtgttcagcacttgcatcag
cgagaggttctccatttagatctcaaacccgaaaacatcatgcttattagaccggaaagt
aaacaaatcaagcttattgacttcggcctggcgaggaagtacaacccgaaggaaaacctc
aaggtaatgtttggaacaccagaatttgtcgccccagaagtcattacatacgagcgaatt
acacctgccacggacttatggtctattggagtcatagcatatattctgctgagtggttta
tcgccttttatgggggatactgatgcagagaccctgacgaatgtccaactggcggagtgg
gactttgacgatcctgtctttgatgatatctcagatgaagcgaaagacttcatcagtggt
cttcttgtgcttaaagcaaacaaaaggagtacggtcgatcaattacttaaacatcgctgg
ttcaccatcaagaaggacaaagggaagaaactgaaaaccgatcgtcttaaagcattcacc
gcgcgaaggaaatggaggcgagccatcaccgcgatccgaagcacgaactttttgagccgg
attctcggaagtcggggatccgatgataagaagagcagcggcggtggagggggtggattg
ttagcccgagtcaaagcaatgcatgctgccggtatacaaggttcggaagggggtgtcccc
ccggcgtcgtctcctttcctatcacctgcctcagcagctttcagcaccagtaacagcttc
acatcagtaacagtaacagaaagaacgcaaacgcagggagagacaactgttacagagaaa
gagacagtgactgttaccaaagacggacaaacaactgttgaagaaaaagaaactacaaca
agaatcggcgaaaccacacagcaagaaaacaaaaccgaagaagtcgataatggtaagacg
ggcggtcttggaggagcagccaacactccacaagccatcgctaagcgctattccactggt
ggagtggcacttaaactggaaaatgtcgacaagttttggggaataaagcacgaaatagca
aagggtcgtttctcagttataaagcgctgcttagacgccaaaacaaagaaaccttttgta
gcgaaaataatcaaatatgacgacgacacagaccgcgaagatactcttcaggaatttgac
atccatcgaagcatcaaaggagacaaagtcgttatgttgcgagatgcattcctcgtgagg
agatatcttgtccttgttatggacatgctggagggacaagatatcctaagctttgttgga
tcaaaacccaggccgagtgaggaagacatctgttttgtaattcgacctttgcttgatgta
gtgaattatcttcatggccagcagattgttcacttagacataaggcctgcaaacattttc
attgccaagagtaacctgggtgtgaaacttatcgattacggaagtgcacgccgcatcaag
aactggaaggaaggtgacatgctggccattgttagttatgttgcattcacagctccagag
ctgctggacttcgctcccgtcagtggaccagcagacatgtggagcattggtgttctcatc
tacgctctcataagtggaatgctgcctttctccgtggaaacgaaggatgacgaagacgaa
gatgaaaaacttggtgaggcgatcaagaggggtaaatggtcttttgactccaaagcattt
caacgcaacacctcagaagtaaaggatctgatcacttctctactttctaaggacgccaaa
aaacgtcccaccgcagaagaggctgcgaaacatccctggctgatgggcgataacatgcag
aaacgtcgttcaagtgacgtggtgagctccaagctcaaagatctgagccagaaacttctg
ttaaaggacaaggaagatgttgtgtcagcgtcctgtgtcctaaaaaccttcaacgaggat
ccttacggctctccagactcagatgaggaatag

DBGET integrated database retrieval system