KEGG   Stylophora pistillata: 111343031Help
Entry
111343031         CDS       T05774                                 

Definition
(RefSeq) heat shock 70 kDa protein PPF203-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
spis  Stylophora pistillata
Pathway
spis03040  Spliceosome
spis04141  Protein processing in endoplasmic reticulum
spis04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:spis00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    111343031
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    111343031
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    111343031
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:spis01009]
    111343031
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:spis03041]
    111343031
   03009 Ribosome biogenesis [BR:spis03009]
    111343031
   03110 Chaperones and folding catalysts [BR:spis03110]
    111343031
   04131 Membrane trafficking [BR:spis04131]
    111343031
   03051 Proteasome [BR:spis03051]
    111343031
   03029 Mitochondrial biogenesis [BR:spis03029]
    111343031
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:spis04147]
    111343031
Protein phosphatases and associated proteins [BR:spis01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     111343031
Spliceosome [BR:spis03041]
 Complex B
  Other components
   Prp19 complex
    111343031
 Complex C
   Prp19-CDC5 complex
    111343031
Ribosome biogenesis [BR:spis03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    111343031
Chaperones and folding catalysts [BR:spis03110]
 Heat shock proteins
  HSP70 / DNAK
   111343031
Membrane trafficking [BR:spis04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    111343031
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    111343031
Proteasome [BR:spis03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    111343031
Mitochondrial biogenesis [BR:spis03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    111343031
Exosome [BR:spis04147]
 Exosomal proteins
  Proteins found in most exosomes
   111343031
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70
Motif
Other DBs
NCBI-GeneID: 111343031
NCBI-ProteinID: XP_022805899
Position
Unknown
AA seq 270 aa AA seqDB search
MERTECPRVLISKPVVLFDKLGSAREGFSHYFGEGCGEMSPLVIRKVSASTASSVTGSEL
PVSIEKLTITQRERANATRVSKEFTTYSDNQPAVTIQVFEGERALTEDNNELGRFELSGI
PPAPRGVPKIEVSLDIDANGILNVSAKDQSTGRTSTITITNDKGRLSKANIDRMVAEAER
YKEEDEKQRQKISARNSLENYAYNVKQSIEDPNVENKLSSADLEAVKSKVQEVIDWLDKN
LQADKEQFEEREKDLQKVCSPIMAKFYEQQ
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atggagagaactgaatgccctcgtgttttgatttcaaagcctgtcgttttgtttgataag
ctaggctctgccagagaaggtttttctcattacttcggagaaggctgtggagaaatgagt
ccactcgtgataaggaaggtgtctgcctcgactgcctcatcggtcacaggttccgagtta
cctgtcagtattgaaaagctaactattactcaacgcgagagagcaaatgcaaccagggtt
tcaaaagagtttactacatactcagataatcagccagctgttaccattcaggtgtttgaa
ggagagcgtgccctgaccgaagacaacaatgaactgggacgatttgagctgagcggaatc
ccacccgctccccggggtgtgcccaaaattgaagtctctttggatattgatgccaatggg
atcttgaacgtgtccgcgaaggatcaaagcactggtagaaccagcaccatcactatcacc
aacgacaagggaaggttgtccaaagctaacattgatcgcatggtggctgaagccgagaga
tacaaggaagaagacgagaagcaacgtcagaaaatctcagccagaaacagcttggaaaac
tatgcgtataacgtcaaacaatcgattgaagatccgaacgtggagaacaaactcagttct
gcagatctggaggcggtaaaaagcaaggtgcaagaagtaatcgattggctggacaaaaat
ttacaggcagacaaagaacagttcgaagagagggagaaagatctacaaaaagtgtgttca
ccaatcatggcgaagttctatgaacagcagtag

DBGET integrated database retrieval system