KEGG   Stylophora pistillata: 111344236Help
Entry
111344236         CDS       T05774                                 

Definition
(RefSeq) glutathione peroxidase 1-like isoform X1
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
spis  Stylophora pistillata
Pathway
spis00480  Glutathione metabolism
spis00590  Arachidonic acid metabolism
spis01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spis00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    111344236
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    111344236
Enzymes [BR:spis01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     111344236
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin DUF4003
Motif
Other DBs
NCBI-GeneID: 111344236
NCBI-ProteinID: XP_022807180
Position
Unknown
AA seq 192 aa AA seqDB search
MEVWQFGMILLLGFGTDLIESSDFYSLNVEDLKGNIVPMSVFKGKVLLIVNVASECGYTD
QHYKEMVELQTKFDSHGFNILAFPCNQFGKQEPLRNSGIARFVKNKYNVNFPVFSKIKVV
GREAHPLYTYLYASVKYAPQWNFAKYLVSRAGKVIQFWSQHYSPLALENFINKYVNMAIT
DEYEVYNVYKEL
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atggaggtctggcagttcggcatgattttgctgcttggcttcggaacagatttgatcgaa
tcttcggatttctattctttaaatgtggaagatttaaagggaaatatcgtaccaatgagt
gtgtttaaaggaaaggtgttgttgattgtgaatgttgccagtgaatgtggttacacagat
cagcattataaagaaatggttgaactacagacaaagtttgatagccatggtttcaacatc
cttgcatttccgtgcaatcagtttggcaaacaggaacccttaaggaatagcggcattgct
agatttgtgaaaaacaaatacaatgtgaactttccagtgttttcgaagatcaaggttgtt
ggaagagaagcccatcctttgtacacgtacctttatgcaagtgtgaaatatgctccacaa
tggaattttgccaaatatcttgtgagtagagcaggcaaagtgattcaattttggagtcaa
cattattcacctttggctctggagaattttatcaacaaatatgtgaatatggcaataact
gatgaatatgaagtctataatgtttataaggaactatga

DBGET integrated database retrieval system