KEGG   Spiribacter curvatus: SPICUR_02575Help
Entry
SPICUR_02575      CDS       T02888                                 

Definition
(GenBank) hypothetical protein
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
spiu  Spiribacter curvatus
Pathway
spiu00450  Selenocompound metabolism
spiu00970  Aminoacyl-tRNA biosynthesis
spiu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spiu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    SPICUR_02575
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SPICUR_02575
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:spiu01007]
    SPICUR_02575
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:spiu03016]
    SPICUR_02575
Enzymes [BR:spiu01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     SPICUR_02575
Amino acid related enzymes [BR:spiu01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   SPICUR_02575
Transfer RNA biogenesis [BR:spiu03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    SPICUR_02575
 Prokaryotic type
   Other AARSs
    SPICUR_02575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1
Motif
Other DBs
NCBI-ProteinID: AGY91528
UniProt: U5T5B1
Position
complement(518102..519754)
Genome map
AA seq 550 aa AA seqDB search
MARKILVTSALPYANGPIHLGHLVEYVQTDIWVRFQKLQGNQCWYVCADDAHGTPIMLKA
RERGITPEALIEQVGMEHRRDFAGFNIGFDNYYTTHSDENRHYSELIYTRLRDGGWIDRQ
TITQAYDEQEGMFLPDRYIKGTCPRCAADDQYGDNCEACGASYSPDELRDPVSVISGQPP
VQRESEHYFFRLQDFEHMLRTWASSEGLQDEVSNKLQEWFDAGLRAWDISRDAPYFGFRI
PDTDNKYFYVWLDAPIGYMASFQDLCNREGLDFDEWWNADSDAELYHFIGKDIVYFHALF
WPAMLSGAGFRTPTRVCAHGFLTVDGQKMSKSRGTFIMADTYLRHLDAEYLRYYFAAKLG
AGVHDIDLSLDDFTQRVNADLVGKLVNIASRCAGFINKRSAGRLGPRLDAPELFRRMSAR
AEVIGGYYENRAYARVVREVMSLADEANQYIDEKKPWVLAKDPDQAEAVQAINTTGINLF
RVLMLYLKPVLPETAAAAERFLQIPAMQWSDAGQPLLDHEIAAFKPLMTRVDPAAIEAMI
ADSRESLKPA
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgcaagatcctggtcaccagcgccctaccctatgccaacgggccgatccacctg
ggccatctcgttgaatacgtccagaccgacatctgggtgcgtttccaaaagctacagggc
aaccagtgctggtatgtatgcgcggatgatgcccatggcacccccatcatgctcaaggcc
cgggagcgtggcatcacccccgaggcgctgatcgagcaggtgggcatggagcatcgccgg
gacttcgcgggcttcaacatcgggtttgacaactactacaccacccactccgacgagaac
cgccattactccgaactgatctatacgcggctgcgggacggtggctggatcgatcgtcag
accatcactcaggcctatgatgagcaagaggggatgttcctgcccgatcgctatatcaag
ggcacctgcccgcgctgcgccgccgatgaccagtacggcgacaactgcgaggcctgcgga
gcaagctactcccccgatgagctgcgcgatccagtctccgtcatctccggccagccaccc
gtccagcgcgagtcagagcattacttcttccgactccaggacttcgagcacatgctccgt
acctgggcgtccagcgagggcctgcaggacgaggtctcgaataagctccaggagtggttc
gatgccgggctccgcgcctgggacatctcccgtgacgcaccctacttcgggttccgcatc
ccagacaccgacaacaagtatttctacgtctggctggacgcgccgatcggctacatggcg
agtttccaggacctttgcaatcgcgaggggctggatttcgatgaatggtggaatgccgat
tcagacgccgagctctatcacttcatcggtaaggacatcgtctatttccatgcgcttttc
tggccggcgatgctgagcggagccggctttcgcacaccgacccgggtctgcgcccacggc
tttctgaccgtcgacggacagaagatgtcgaagtcgcgcgggacctttatcatggccgac
acctatctgcgccacctcgatgccgagtacctccgctactactttgccgccaagctgggg
gcgggcgttcatgacatcgatctgagcctggacgacttcacacagcgggtgaacgcggat
ctggtcggtaaactcgtcaacatcgcgagccgatgcgcaggattcatcaacaagcgatcc
gcgggccggctggggccacggctcgacgcgccggagctgttccgccgcatgagcgcccgc
gctgaggtgatcggcggctactacgagaatcgggcctacgcccgggtggtccgcgaggtg
atgtcgctggccgatgaggccaaccaatatatcgacgagaaaaagccctgggtacttgcg
aaggatccggatcaggctgaggcggttcaggccatcaacaccaccggaatcaatctgttc
cgggtgctgatgctctacctcaagccggtcctcccggaaacggcggcggccgccgagcgt
ttcctgcagatccctgccatgcagtggtccgacgccggacagccgctgctcgaccatgag
atcgcggcgttcaagcctctgatgacgcgggtcgatccggccgccatcgaggccatgatc
gcggactcgcgggagagcctgaagccggcatga

DBGET integrated database retrieval system