KEGG   Spiribacter sp. UAH-SP71: SPICUR_03755Help
Entry
SPICUR_03755      CDS       T02888                                 

Definition
(GenBank) hypothetical protein
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
spiu  Spiribacter sp. UAH-SP71
Pathway
spiu00730  Thiamine metabolism
spiu00790  Folate biosynthesis
spiu01100  Metabolic pathways
spiu02020  Two-component system
Module
spiu_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:spiu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    SPICUR_03755
   00790 Folate biosynthesis
    SPICUR_03755
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SPICUR_03755
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:spiu04147]
    SPICUR_03755
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:spiu00537]
    SPICUR_03755
Enzymes [BR:spiu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     SPICUR_03755
Exosome [BR:spiu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SPICUR_03755
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:spiu00537]
 Enzymes
  SPICUR_03755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme DUF4609
Motif
Other DBs
NCBI-ProteinID: AGY91742
UniProt: U5T6E5
Position
752481..753887
Genome map
AA seq 468 aa AA seqDB search
MNLRHFSATLLAATIATPALGQTITQTDNEWFEAGQARIQSELAKQQNTNTAKNVILMVA
DGNGVGTNYATRLFMGQQDGGYGDEYVMPYETFPHLGFAKVYNVNAQTPDSAGTGTAMMG
GVKTKAGLIGVTADVDRGDCSTLPGNTVTGISEILHGMGKSTGFVTTARVTHATPASTYA
KTVDRNFEDDSELPENCNTQTDIATQLIDAMDSGLIQVAMGGGARHFVPTDEELLVGGTG
RRTDDQNLIEEATELGAYHAYDNASFADAPTDGTPLLGLFESSHMMYSADRYDEPSIADM
AEAAVESLSNDEDGFFLQVESGRVDHANHAGNLARVVHDGAAFAEAVDRVVNMVDLSETL
VIVTADHEHAIAFNGYCGRGSDILGLCMGIDGSGVEHTGEPRLGSDDKPYTVAGYLNGPG
SVLMKREDGSYSGSRPEVSEAQATDIDYIQQALVPRSSETHAGPDVAI
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgaaccttcgacacttttccgcaacactacttgcggcgacgattgcgacaccggcactc
ggccagaccatcacacagacggacaacgagtggttcgaggccggacaggcacgcattcag
agcgagcttgccaagcagcagaatacgaacaccgccaagaacgtcatccttatggttgca
gacggcaacggtgtggggaccaactacgcgacccgccttttcatgggccagcaggacggt
ggctacggtgatgagtacgtcatgccgtatgaaaccttcccgcatctgggctttgccaag
gtttacaacgtgaacgcccagacccccgacagcgctggcaccggcaccgcgatgatgggc
ggtgtcaaaaccaaggccggtctgatcggcgtcaccgcggacgtcgatcggggcgactgc
tcgaccctgccgggtaacacggtgacgggcatttcggagattctccacggcatgggcaag
tcgacgggtttcgtcaccaccgcccgcgtgacccatgcgacgcccgcttccacttatgcg
aaaaccgtggatcgtaacttcgaggacgactctgagctgcccgagaactgtaatacccag
acggatatcgccacgcagctgattgatgccatggactcgggcctgattcaggtggcgatg
ggtggcggcgcgcgtcacttcgtgccgactgacgaggagctgctggtcggcgggacaggc
cgtcgcaccgacgatcagaacttgatcgaggaggcgacggagctgggcgcttatcatgcc
tatgacaacgcgtcatttgccgatgcgcccacggacggcacaccgctgctcggtctgttc
gagtcatcgcatatgatgtattccgccgatcgctatgatgagccgtccatcgccgatatg
gccgaggcggcggtggagtcgctatccaacgatgaggacggtttcttcctgcaggtggag
tcggggcgcgttgaccatgccaaccatgccggcaacctggcgcgggtggtgcatgacggt
gccgcctttgccgaggccgtcgaccgggtggtcaacatggtcgatctctccgagacgctg
gtcatcgtgaccgccgaccatgagcatgccattgccttcaacggctactgtggccgcggc
tcggacatcctcgggctgtgcatggggattgatggcagtggtgtcgagcacaccggcgag
ccgcgtctgggttcggacgacaagccctacacggtggcgggctatctcaatggtccgggc
tccgtgctgatgaagcgcgaagatggcagctattccggcagccgccccgaggtctccgag
gcgcaggccacggatatcgactatatccagcaggccctggtgccgcgcagttccgagacc
cacgccgggccggacgtcgcgatctag

DBGET integrated database retrieval system