KEGG   Spiribacter sp. UAH-SP71: SPICUR_04340Help
Entry
SPICUR_04340      CDS       T02888                                 

Definition
(GenBank) dihydromonapterin reductase
  KO
K13938  dihydromonapterin reductase / dihydrofolate reductase [EC:1.5.1.50 1.5.1.3]
Organism
spiu  Spiribacter sp. UAH-SP71
Pathway
spiu00670  One carbon pool by folate
spiu00790  Folate biosynthesis
spiu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spiu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SPICUR_04340
   00670 One carbon pool by folate
    SPICUR_04340
Enzymes [BR:spiu01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     SPICUR_04340
    1.5.1.50  dihydromonapterin reductase
     SPICUR_04340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase NmrA
Motif
Other DBs
NCBI-ProteinID: AGY91849
UniProt: U5T2T3
Position
867755..868462
Genome map
AA seq 235 aa AA seqDB search
MTAPILITGASQRIGLAYAMHCLERGTPVIATYRTHRSAVDTLEQAGARCLHADFATNQG
IDSFINALLEETSALRAIIHNASDWLPESPDTDPADVMAAMMQIHSTTPYRINLACRHLL
ENSDAVTDIVHMTDYVVEKGSAKHIAYAASKAALENLTRSFARLLSPGVKVNSVAPSLIM
FNEGDSEAYREKTLKKSLLGIAPGEVAAVETLQFLLDNPYITGRSIGLDGGRHLV
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcacccatcctgattaccggtgccagccagcgtatcgggcttgcctacgcgatg
cactgcctggaacggggcacacccgtgattgcgacctaccgcacccatcggtccgcggtg
gatacactcgagcaggcgggcgcacgatgcctgcacgcggacttcgccaccaatcagggc
attgattcgttcatcaacgcgctactggaagagacctctgcgctgcgcgccattatccac
aatgcctcggactggctgccggaaagcccagacacagaccccgccgatgtgatggcggcc
atgatgcagattcacagcacgacgccgtatcgcatcaaccttgcctgcaggcacttactt
gaaaacagcgacgccgtgacggatatcgtgcacatgactgactacgtcgttgagaaaggc
agcgcgaagcacatcgcctacgccgccagtaaagccgctctggagaacctgacgcggtct
ttcgcacggcttctctcacccggggtaaaggtgaatagtgtcgcgccctcgttgatcatg
ttcaatgagggtgacagcgaggcatatcgggaaaaaacgctgaagaaatccctgctgggc
attgcaccgggcgaagttgctgcggtggagacgctgcagttcctgctcgataacccgtat
atcactggccgcagtatcggactggatggcgggcggcatctggtctga

DBGET integrated database retrieval system