KEGG   Spiribacter curvatus: SPICUR_07335Help
Entry
SPICUR_07335      CDS       T02888                                 

Definition
(GenBank) hypothetical protein
  KO
K07053  3',5'-nucleoside bisphosphate phosphatase [EC:3.1.3.97]
Organism
spiu  Spiribacter curvatus
Brite
KEGG Orthology (KO) [BR:spiu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SPICUR_07335
Enzymes [BR:spiu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.97  3',5'-nucleoside bisphosphate phosphatase
     SPICUR_07335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHP
Motif
Other DBs
NCBI-ProteinID: AGY92430
UniProt: U5T4P0
Position
complement(1486856..1487740)
Genome map
AA seq 294 aa AA seqDB search
MKATSEAPVSASQVDLHMHSTASDGHLSPAAVVARAAARGVRLMALTDHDSLDGVVEAQA
SARGQGIECLSGIELSARWARGVVHIVGLGMDITCPTLIEGVARQQAERHDRAARIAERL
AAAGVAGMADRVDEMAAGVPGRAHFARALVEQGASPTFQAAFERYLKRGRPGYAAVQWAS
IDEVVAWIHAAGGTAVFAHPLRYGLTRGALRAAIQAFVGAGGEAIEVANGGGGRDDLSAA
AALARRFGLTASKGSDFHDPDFPWVEIGRLEPIPRDLTPVWETLGAVSDEPAND
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgaaggccacaagcgaggcgccagtgtccgccagccaggttgatttacacatgcacagt
accgcctcggatggccacctgtcgccagcggcggtggtggcgcgggcggctgcgcggggc
gtgcggctgatggcactcaccgaccacgacagcctcgacggcgtggtcgaggcacaggcg
agcgcccgcgggcagggcattgagtgtctgagcggtatcgagctctcggcacgatgggcg
agaggtgtggtgcatatcgttggcctcggcatggacattacctgcccgacactgattgag
ggtgtggcgcgacagcaggccgagcgccatgaccgcgccgcccgcatcgctgagcgactg
gcggctgcgggcgttgccggcatggccgatcgggtggatgagatggcggctggcgttccc
ggtcgcgcgcatttcgcccgcgcactggttgagcagggggcctcgccgacgtttcaggcg
gcatttgaacgctatctcaaacgcggtcggcccggctatgccgctgtgcaatgggcgagt
atcgacgaggttgtcgcctggatccatgccgctggcggtaccgctgtgtttgcccatccg
cttcgctatggtctgacccgcggtgcgctgcgggcggcgattcaggcctttgtcggcgct
ggcggtgaggcgattgaggtcgccaacggtggtggcgggcgtgacgacctctcggcggcc
gcggcactggcgcgccgatttggcctcactgcctccaagggctcggatttccacgatcca
gacttcccctgggtcgagatcggtcggctcgagcccattccccgtgatctcacgccggtc
tgggagaccctcggagcggtctcggatgagccagccaatgactga

DBGET integrated database retrieval system