KEGG   Spiribacter curvatus: SPICUR_08025Help
Entry
SPICUR_08025      CDS       T02888                                 

Definition
(GenBank) hypothetical protein
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
spiu  Spiribacter curvatus
Brite
KEGG Orthology (KO) [BR:spiu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SPICUR_08025
Enzymes [BR:spiu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     SPICUR_08025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: AGY92561
UniProt: U5T5H9
Position
complement(1617154..1617999)
Genome map
AA seq 281 aa AA seqDB search
MATMSDTSVERPTRAAVVQMVSAMDVAGNLADAGALIDSAVAQGAELVVLPENFAFLGRQ
QRDTLTVAENEGEGPIQAFLADTAYRHGITLVGGSLPLQGGETDRVRAACLVYGPSGERI
ARYDKRHLFDVSLPGSETYRESATFAAGDAVVVAPTPVGRLGLSICYDLRFPEHYRALVD
AGADILLAPSAFTATTGAAHWSVLVRARAIENGCYMLAPDQGGRHANARATHGESLIVDP
WGECIASAGIGAGPAVAVADLDPGHQRAIRARLPALAHRRG
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgatgagtgacacgagtgtggagcggccgacccgggccgctgtggtgcagatg
gtctcggcgatggatgtggcgggcaatctcgctgatgcgggtgcattgatcgactcggcg
gtggcacagggcgcggaactcgtcgtgctgccggagaacttcgcgtttctcggtcgccag
cagcgtgacacgctcaccgtggcggaaaatgagggtgagggaccgattcaggcctttctg
gccgatacagcgtatcgccacggcatcaccctggtcggcggcagcctgccgctacagggc
ggcgagacggaccgcgtccgcgccgcctgcctggtctatggcccgagcggtgagcggatc
gcgcgctatgacaaacggcatctgttcgatgtctcgctccccggcagcgagacctaccgc
gagtcggcgacgtttgcggcgggtgatgcggtggtcgtcgcgccgacacccgtcgggcga
ttggggctgtcgatctgttatgacctgcgcttcccggagcactaccgggccctggtggac
gcgggtgccgacatcctgctcgcgccctcggcgttcaccgccacgaccggtgctgcccac
tggtcggtgctggtgcgcgcacgggccatcgagaacggctgttacatgctggcccccgac
cagggcgggcgtcatgccaacgcgcgtgccacccatggcgagagtctgatcgtcgacccc
tggggcgagtgcatcgcgagcgccgggatcggcgccggcccggcggtcgccgtggccgac
ctggaccccggtcatcagcgcgccattcgagcgcggctgccggccctggcgcatcgccgg
ggctga

DBGET integrated database retrieval system