KEGG   Streptococcus pyogenes MGAS2096 (serotype M12): MGAS2096_Spy1777
Entry
MGAS2096_Spy1777  CDS       T00357                                 

Symbol
pflD
Name
(GenBank) Formate acetyltransferase
Organism
spj  Streptococcus pyogenes MGAS2096 (serotype M12)
SSDB
Motif
Pfam: PFL-like Gly_radical DUF3029
Other DBs
NCBI-ProteinID: ABF36829
Position
complement(1728268..1730685)
AA seq 805 aa
MTETKSPYFGHLTDRMTHYREAVLDKKPYIDAERAILATEAYQKHQNKPANLKRAYMLQT
ILENMTIYIEDESLIAGNQASSNKDAPIFPEYTLEFVLNELDLFEKRDGDVFYITEETKQ
QLRDIAPFWENNNLRARCGVLLPEEVQVYMETGFFGMEGKMNSGDAHLAVNYQKLLEHGL
KGFEERARAAKAALDLTIPENIDKYHFYDSVFIVIDAVKTYAKRYAKLARELAKTAKPER
QAELLDIARICDKVPYEPAKTFAEAVQSVWFIQCILQIESNGHSLSYGRFDQYMYPYVKA
DLEAGRETEASIVERLTNLWIKTLTINKVRSQAHTFSSAGSPLYQNVTIGGQTRDKKDAV
NPLSYLVLRSVAQTKLPQPNLTVRYHKGLDNTFMNECIEVMKLGFGMPAMNNDEIIIPSF
IKKGVSEEDAYDYSAIGCVETAVPGKWGYRCTGMSYINFPKILLITMNDGIDPASGKRFA
KGHGHFKDMTSYEELKAAWDATLREITRMSVIVENAIDLGLEREVPDILCSALTDDCIGR
GKTLKEGGAVYDYISGLQVGIANLSDSLAALKKLVFEEGQLTPEELWQALESDFAGERGE
EIRQMLINDAPKYGNDDDYADSLVVEAYDTYIDEIAKYPNTRYGRGPIGGIRYSGTSSIS
ANVGQGKGTLATPDGRHAGTPLAEGCSPEHSMDKKGPTSVLKSVAKLPTDEIVGGVLLNQ
KVNPQTLAKEEDKLKLMALLRTFFNRLHGYHIQYNVVSRETLIDAQKHPEKHRDLIVRVA
GYSAFFNVLSKATQDDIIERTEHTL
NT seq 2418 nt   +upstreamnt  +downstreamnt
atgactgaaacaaaaagcccttattttggacatttaacagacagaatgactcactatcgt
gaagctgtgttagacaagaaaccttatattgatgctgagcgtgctattttagccactgaa
gcctatcaaaaacaccaaaataagccagcaaacctcaaacgcgcttacatgcttcaaact
attttagaaaacatgaccatctatattgaggatgaaagcctcattgctggtaaccaagcc
tcttcgaacaaggatgcgccgattttcccagaatacactctggaatttgtcctcaacgaa
cttgatctttttgaaaaacgagatggggatgtcttctacattaccgaagaaaccaagcaa
cagctccgagacattgccccattctgggaaaacaataacctgcgtgctcgctgcggtgtc
ttgctaccagaagaagtgcaagtgtacatggaaacaggtttctttggcatggaaggcaag
atgaactctggggatgcccatttagcggttaattaccaaaaactcttggaacacggctta
aagggatttgaagaacgggcacgagctgccaaggctgcgcttgatctgaccattcctgaa
aacattgacaaataccatttttacgactctgtttttattgtcattgatgcagtcaaaact
tatgctaaacgctatgccaagttggctagagaactagcaaaaacggctaaaccagaacgt
caagcagaattgttagacatcgcacgcatttgtgacaaagtgccttacgaaccagcgaaa
acctttgcagaggctgtacaatccgtctggttcattcagtgtatcttgcaaattgaatca
aacgggcattccctatcttatggccgctttgaccagtacatgtatccttatgtcaaagct
gatttggaggctggccgtgaaacagaagcctcaatcgttgaacgtttgaccaacctctgg
attaagaccttgaccattaataaagtacggagccaagcccacaccttctcatcagcaggt
agtccactttaccaaaacgtgacgatcggcggtcaaacacgcgataaaaaagacgcggtc
aacccactgtcttaccttgtcctacggagtgtggctcaaaccaaattgccacaacctaac
ttgactgttcgttaccataaaggcctagacaatacctttatgaacgaatgtattgaggtc
atgaaacttggttttggcatgccagccatgaacaacgatgaaatcatcattccatccttt
atcaaaaaaggtgtctcagaagaagacgcttatgattattcagccattggttgtgtggaa
acagcagttcctgggaaatggggctaccgttgcacggggatgagttacatcaacttccct
aaaatcttgctgattaccatgaatgacgggattgacccagcatcaggcaagcgctttgca
aaaggacacggtcatttcaaagacatgacctcttatgaagaattaaaagcagcatgggat
gccaccctgcgcgaaattacccgcatgagcgtcattgttgaaaatgccattgacctaggt
cttgaacgtgaagtaccagatattctttgctcagccttgacagatgattgtatcggtcgt
ggcaagaccttaaaagaaggcggagctgtttacgactatatctcaggccttcaagttggt
attgccaacctatcagactccctagcagcgctgaaaaaattagtgtttgaagaaggtcaa
ttaactccagaagaactctggcaggcccttgaaagtgactttgctggagagcgcggagaa
gagatccgacaaatgctcatcaatgacgcaccaaaatatggtaatgatgatgactacgca
gatagtttagttgtcgaagcttacgacacctacattgatgaaattgccaaatacccaaat
acccggtatggccgtggcccaatcggaggtatccgctattctgggacatcatcaatctca
gccaatgtcggacaaggaaaagggaccttggcaacaccagacggtcgccatgcagggaca
ccactagcagaaggctgttcaccagaacacagcatggacaaaaaaggcccgacttcagta
ttgaaatctgttgctaaattaccaacagatgagattgtcggaggagtgctactcaaccaa
aaagttaacccacaaaccctggccaaagaagaagacaaactgaaattaatggccttactt
cgtactttctttaatcgcctacacggttatcatatccagtacaatgtcgtgtcacgtgaa
accttgattgatgcccaaaaacatcctgaaaagcaccgtgacctcattgtccgtgttgcc
ggctactcagctttcttcaatgtgctctcaaaagcaacccaagatgacattattgaacgt
acagaacacacactttag

DBGET integrated database retrieval system