KEGG   Streptococcus pyogenes MGAS2096 (serotype M12): MGAS2096_Spy0154Help
Entry
MGAS2096_Spy0154  CDS       T00357                                 

Gene name
leuS
Definition
(GenBank) Leucyl-tRNA synthetase
  KO
K01869  leucyl-tRNA synthetase [EC:6.1.1.4]
Organism
spj  Streptococcus pyogenes MGAS2096 (serotype M12)
Pathway
spj00970  Aminoacyl-tRNA biosynthesis
Module
spj_M00360  Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:spj00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    MGAS2096_Spy0154 (leuS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:spj01007]
    MGAS2096_Spy0154 (leuS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:spj03016]
    MGAS2096_Spy0154 (leuS)
   03029 Mitochondrial biogenesis [BR:spj03029]
    MGAS2096_Spy0154 (leuS)
Enzymes [BR:spj01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.4  leucine---tRNA ligase
     MGAS2096_Spy0154 (leuS)
Amino acid related enzymes [BR:spj01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   MGAS2096_Spy0154 (leuS)
Transfer RNA biogenesis [BR:spj03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    MGAS2096_Spy0154 (leuS)
 Prokaryotic Type
    MGAS2096_Spy0154 (leuS)
Mitochondrial biogenesis [BR:spj03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    MGAS2096_Spy0154 (leuS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1_2 tRNA-synt_1 tRNA-synt_1g Anticodon_1 tRNA-synt_1e
Motif
Other DBs
NCBI-ProteinID: ABF35206
UniProt: Q1JDV2
Position
162974..165475
Genome map
AA seq 833 aa AA seqDB search
MTFYDHTAIEPKWQAFWADNHTFKTGTDASKPKFYALDMFPYPSGAGLHVGHPEGYTATD
ILSRFKRAQGHNVLHPMGWDAFGLPAEQYAMDTGNDPAEFTAENIANFKRQINALGFSYD
WDREVNTTDPNYYKWTQWIFTKLYEKGLAYEAEVPVNWVEELGTAIANEEVLPDGTSERG
GYPVVRKPMRQWMLKITAYAERLLEDLEEVDWPESIKDMQRNWIGKSTGANVTFKVKDTD
KDFTVFTTRPDTLFGATYAVLAPEHALVDAITTSDQAEAVADYKRQASLKSDLARTDLAK
EKTGVWTGSYAINPVNGKEMPVWIADYVLASYGTGAIMAVPAHDERDWEFAKQFNLDIIP
VLEGGNVEEAAFTEDGLHINSDFLDGLDKASAIAKMVEWLEAEGVGNENVTYRLRDWLFS
RQRYWGEPIPIIHWEDGTSTAVPESELPLVLPVTKDIRPSGTGESPLANVTDWLEVTRED
GVKGRRETNTMPQWAGSSWYYLRYIDPHNTEKLADEELLKQWLPVDIYVGGAEHAVLHLL
YARFWHKVLYDLGVVPTKEPFQKLFNQGMILGTSYRDSRGALVATDKVEKRDGSFFHVET
GEELEQAPAKMSKSLKNVVNPDDVVEQYGADTLRVYEMFMGPLDASIAWSEEGLEGSRKF
LDRVYRLITTKEITEENSGALDKVYNETVKAVTEQVDQMKFNTAIAQLMVFVNAANKEDK
LFSDYAKGFVQLIAPFAPHLGEELWQALTASGESISYVPWPSYDESKLVENDVEIVVQIK
GKVKAKLVVAKDLSREELQEVALANEKVQAEIAGKDIIKVIAVPNKLVNIVIK
NT seq 2502 nt NT seq  +upstreamnt  +downstreamnt
atgacattttacgatcacaccgctattgaacccaaatggcaagccttttgggcagataat
cacacctttaaaacaggaacagacgcatcaaaacctaagttttatgccctagatatgttc
ccatatccatcaggagctggtctccacgttggtcacccagaaggctatacagcaactgat
attcttagccgtttcaaacgtgcccaaggtcacaatgtcctccacccaatgggttgggat
gcctttggacttcctgctgagcagtacgctatggatactggtaatgatccagccgagttt
acagctgaaaacatcgctaacttcaaacgccagattaatgctcttggcttctcatacgac
tgggaccgtgaagttaacacaactgaccctaactactacaagtggacgcagtggatcttt
accaagctttatgaaaaaggtctagcctacgaagctgaagttcccgttaactgggttgaa
gaattgggaacagctatcgccaacgaagaggttcttccagatgggacatcagaacgtggc
ggctatccagttgtcagaaaacccatgcgccaatggatgctcaaaatcactgcctatgca
gagcgcttgctagaagacttggaagaagttgactggccagaatcaatcaaggacatgcaa
cgcaactggattggtaaatcaactggcgctaatgtaaccttcaaggttaaggatacagat
aaggacttcactgtctttacaacacgtcctgacacgctttttggtgcaacttacgccgtt
cttgctcctgagcatgccttggttgatgctattacgacatctgaccaggcagaagccgtg
gctgactacaaacgtcaagcaagtctcaaatcagaccttgctcgtacagaccttgccaaa
gaaaaaactggtgtctggacgggtagctatgcgattaacccggtcaacggcaaagaaatg
ccagtttggattgcggactatgtccttgctagctacggtactggtgctatcatggctgtt
ccagcccacgatgaacgtgactgggaattcgcaaaacaatttaacctagacatcatccct
gttcttgaaggtggtaatgttgaagaggctgcctttacagaagacggtcttcacatcaac
tccgacttcctagatggtcttgacaaagcgtcagctattgccaaaatggtcgaatggctt
gaagcagaaggcgtcggtaatgaaaatgtcacttaccgtctccgtgactggctctttagc
cgtcaacgttactggggtgagccaatcccaatcatccactgggaagatgggacatcaaca
gcggttcctgagagtgaattgccattggttcttccagtaactaaggatattcgtccttca
ggtactggtgagagcccgcttgctaacgtgacagactggttggaagttacccgtgaagat
ggtgttaaaggtcgtcgtgagactaacaccatgccacaatgggcaggttcaagctggtat
tatcttcgttacatcgatccacacaacaccgaaaaactggctgatgaggaactcctcaaa
caatggttgccagttgatatctatgtcggtggtgcagagcatgccgtgcttcaccttctc
tacgctcgcttctggcacaaggttctttacgatctcggtgttgtacctaccaaagagcca
ttccaaaaactctttaaccaagggatgattttggggacaagctaccgcgatagccgtgga
gcgcttgtagcgactgacaaggttgaaaaacgtgatggcagcttcttccatgtggaaact
ggggaagagcttgaacaagcaccagctaagatgtctaaatcacttaagaacgtcgtcaac
ccagatgatgttgttgagcagtacggtgctgacacccttcgtgtttacgagatgttcatg
ggaccacttgacgcttccatcgcttggtctgaagaaggtcttgaaggctcacgtaagttc
ttggaccgtgtttaccgtttgatcacgactaaagagatcactgaggaaaatagcggagcc
cttgacaaggtttacaacgaaaccgttaaggccgttactgagcaagttgaccaaatgaaa
ttcaacacagctatcgctcaactcatggtatttgtcaatgcagccaacaaggaagacaaa
ctctttagcgactatgccaaaggctttgttcaattgattgcaccatttgcaccgcactta
ggtgaggaactctggcaagccttgacagcctcaggtgagtcaatctcttacgtgccatgg
ccaagttatgatgaaagcaaattggttgaaaacgatgtggaaatcgttgtccaaatcaaa
ggtaaggtcaaagctaaacttgtagttgctaaagacctttcacgcgaagaattacaagaa
gttgcccttgctaacgaaaaagtccaagccgaaatcgcaggcaaagacatcatcaaagtc
atcgcagtaccaaacaaactcgttaatattgttatcaaatag

DBGET integrated database retrieval system