KEGG   Streptococcus pyogenes MGAS2096 (serotype M12): MGAS2096_Spy0287Help
Entry
MGAS2096_Spy0287  CDS       T00357                                 

Definition
(GenBank) hypothetical cytosolic protein
Organism
spj  Streptococcus pyogenes MGAS2096 (serotype M12)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transcrip_reg TFIIB
Motif
Other DBs
NCBI-ProteinID: ABF35339
UniProt: Q1JDG9
Position
285237..285953
Genome map
AA seq 238 aa AA seqDB search
MGRKWANIVAKKTAKDGATSKVYAKFGVEIYVAAKQGEPDPELNTALKFVIDRAKQAQVP
KHVIDKAIDKAKGNTDETFVEGRYEGFGPNGSMIIVDTLTSNVNRTAANVRTAYGKNGGN
MGASGSVSYLFDKKGVIVFAGDDADSVFEQLLEADVDVDDVEAEEGTITVYTAPTDLHKG
IQALRDNGVEEFQVTELEMIPQSEVVLEGDDLETFEKLIDALESDDDVQKVYHNVADF
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgggacgtaaatgggcaaatattgttgctaaaaaaactgctaaagatggagcaacatca
aaggtctatgccaaatttggtgttgaaatttatgtggctgccaaacaaggcgagccagat
ccagagttaaatacagctcttaaatttgtcattgatcgtgcaaagcaagcacaagtgcca
aagcatgttattgataaagcgattgataaagctaaaggaaacacagatgaaactttcgta
gagggacgctatgaaggttttggtccaaatggttcaatgattattgtggatactttgaca
tcaaatgttaaccgtacagcggcaaatgtacgtacggcttacggtaagaacggtggcaat
atgggagcttcaggatctgtatcctacttatttgataaaaaaggggtcatcgtttttgct
ggtgatgatgctgacagtgtctttgaacaattacttgaagcggatgtagacgtagatgat
gttgaagcagaagagggaacaataacagtttataccgccccaacagatcttcataaaggt
atccaagcacttcgcgataatggtgtagaagaattccaagttactgaacttgaaatgatt
cctcaatcagaagtagtattggaaggtgatgaccttgaaacttttgaaaagcttattgat
gcactcgaatcagatgatgatgttcaaaaagtgtatcataatgtagcagatttttaa

DBGET integrated database retrieval system