KEGG   Streptococcus pyogenes MGAS2096 (serotype M12): MGAS2096_Spy0410Help
Entry
MGAS2096_Spy0410  CDS       T00357                                 

Gene name
era
Definition
(GenBank) GTP-binding protein era
  KO
K03595  GTPase
Organism
spj  Streptococcus pyogenes MGAS2096 (serotype M12)
Brite
KEGG Orthology (KO) [BR:spj00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:spj03009]
    MGAS2096_Spy0410 (era)
   03029 Mitochondrial biogenesis [BR:spj03029]
    MGAS2096_Spy0410 (era)
Ribosome biogenesis [BR:spj03009]
 Eukaryotic type
  Other ribosome biogenesis factors
   MGAS2096_Spy0410 (era)
 Prokaryotic type
  GTPases
   MGAS2096_Spy0410 (era)
Mitochondrial biogenesis [BR:spj03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    MGAS2096_Spy0410 (era)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MMR_HSR1 KH_2 FeoB_N GTP_EFTU Dynamin_N RsgA_GTPase AIG1 cobW PduV-EutP MMR_HSR1_Xtn Roc AAA KH_4 DUF4548 AAA_22 Ras KH_1 ABC_tran
Motif
Other DBs
NCBI-ProteinID: ABF35462
UniProt: Q1JD46
Position
396574..397470
Genome map
AA seq 298 aa AA seqDB search
MFKSGFVAILGRPNVGKSTFLNHVMGQKIAIMSDKAQTTRNKIMGIYTTETEQIVFIDTP
GIHKPKTALGDFMVESAYSTLREVETVLFMVPADEKRGKGDDMIIERLKAAKIPVILVIN
KIDKVHPDQLLEQIDDFRSQMDFKEVVPISALEGNNVPTLIKLLTDNLEEGFQYFPEDQI
TDHPERFLVSEMVREKVLHLTQQEVPHSVAVVVESMKRDEETDKVHIRATIMVERDSQKG
IIIGKQGAMLKKIGKMARRDIELMLGDKVYLETWVKVKKNWRDKKLDLADFGYNEKEY
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaatcaggctttgtagccattcttggtcgtccaaatgttggcaaatccaccttt
ttaaatcacgtcatggggcaaaaaattgccatcatgagtgacaaggctcagaccacccgt
aataaaattatgggcatttacaccacagaaacagaacaaattgtctttattgatacgcca
ggtattcataaaccaaagaccgcccttggtgattttatggttgaatctgcttatagtact
ttacgtgaagttgagacagttcttttcatggttcctgccgatgaaaagcgtggtaagggt
gacgacatgattatcgagcggctaaaggcagctaagattcctgttattttagtcatcaac
aaaattgataaggttcatccagaccaacttttggaacagattgatgacttccgtagccaa
atggattttaaagaagtggtcccaatttctgccctagaaggtaataatgtgccaacccta
atcaagttattaactgataatcttgaagaaggtttccaatattttccagaagatcagatt
actgatcatccagaacgtttccttgtgtcagaaatggttcgtgagaaggtactgcatttg
acgcaacaagaggttccacattccgtagctgttgttgtcgaatccatgaagcgagatgaa
gagactgataaagtgcatatccgtgcaaccattatggtggagcgcgatagccaaaaaggc
atcatcatcggtaaacaaggagccatgctcaaaaaaatcggaaaaatggcgcgccgtgat
attgaactcatgttaggtgacaaggtctacttagaaacgtgggtcaaagtcaagaaaaac
tggcgggataaaaagcttgatttagctgattttggctataatgagaaagaatactaa

DBGET integrated database retrieval system