KEGG   Streptococcus pyogenes MGAS2096 (serotype M12): MGAS2096_Spy0451Help
Entry
MGAS2096_Spy0451  CDS       T00357                                 

Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
spj  Streptococcus pyogenes MGAS2096 (serotype M12)
Pathway
spj00071  Fatty acid degradation
spj00072  Synthesis and degradation of ketone bodies
spj00280  Valine, leucine and isoleucine degradation
spj00310  Lysine degradation
spj00362  Benzoate degradation
spj00380  Tryptophan metabolism
spj00620  Pyruvate metabolism
spj00630  Glyoxylate and dicarboxylate metabolism
spj00640  Propanoate metabolism
spj00650  Butanoate metabolism
spj00900  Terpenoid backbone biosynthesis
spj01100  Metabolic pathways
spj01110  Biosynthesis of secondary metabolites
spj01120  Microbial metabolism in diverse environments
spj01130  Biosynthesis of antibiotics
spj01200  Carbon metabolism
spj01212  Fatty acid metabolism
spj02020  Two-component system
Brite
KEGG Orthology (KO) [BR:spj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MGAS2096_Spy0451
   00630 Glyoxylate and dicarboxylate metabolism
    MGAS2096_Spy0451
   00640 Propanoate metabolism
    MGAS2096_Spy0451
   00650 Butanoate metabolism
    MGAS2096_Spy0451
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MGAS2096_Spy0451
   00072 Synthesis and degradation of ketone bodies
    MGAS2096_Spy0451
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MGAS2096_Spy0451
   00310 Lysine degradation
    MGAS2096_Spy0451
   00380 Tryptophan metabolism
    MGAS2096_Spy0451
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MGAS2096_Spy0451
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MGAS2096_Spy0451
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    MGAS2096_Spy0451
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:spj04147]
    MGAS2096_Spy0451
Enzymes [BR:spj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MGAS2096_Spy0451
Exosome [BR:spj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MGAS2096_Spy0451
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ABF35503
Position
429709..430857
Genome map
AA seq 382 aa AA seqDB search
MTDVYIAAGLRTPIGLVGKQFAKEQPEILGAKLINALQNKYPVPIDQVICGNAVGTGGNI
GRLMTLYSHLGESVSALTVDMQCASAGAALSVGYAKIKAGMASNLLVGGIESSSLQPESV
YASADWRQGAYKVAQFSPDSISPFAMIEGAERVAREHGFTKEYLNHWILRSHQKASYCQE
QALLADLILDLPGASDQGIRPRLSSKVLSKVPPILGEDHVISAANACLTHDAAAFLQLSS
QPSAFKLIDVVEVAGDPQRSPLMVIKASQVLLEKHGLGMADMTAIEWNEAFAVIDGLFET
HYPDLLDRYNIFGGALAYGHPYGASAAIIILHLMRALEIKNGHYGIAAIAAAGGQGFAVL
LKYHKEFSHADKARILGKAMPK
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgacggatgtttatattgctgcaggccttagaacccctatcggtttagtagggaaacaa
tttgctaaagaacaaccagaaatccttggagcaaagctcatcaatgctttacaaaataag
tatccagttcccattgaccaagtgatttgtggcaatgccgtcggaacgggtggtaatatt
gggcgcttgatgaccctgtattctcatttaggagaatctgtctctgctttgacggttgat
atgcagtgtgcatcagctggtgcagctctttccgtgggttatgctaaaatcaaggcaggt
atggcaagcaaccttttagtgggagggattgaaagcagctccttacaacctgaatcggta
tatgcttcagctgattggcgccaaggagcctacaaggtagctcagttttctccagatagt
atcagcccttttgcgatgattgaaggggcagaacgagtggcaagagagcatggctttaca
aaggagtatttgaatcactggatattgagaagtcatcaaaaggctagttattgccaggag
caagccctgttagctgatcttattctagacctgccaggagccagtgatcaaggtattcga
ccgcgcttgtcaagtaaggtgttgtcaaaggtaccccctatcttaggagaagatcacgtg
attagtgcagccaatgcctgcctaacccatgatgctgctgcctttttacagctaagtagt
cagccttcagcttttaaactgattgatgtggtagaagtagcaggagacccacagcgtagc
cctttaatggtgattaaggctagtcaagtccttttggaaaaacatggtctagggatggca
gatatgacagcgattgaatggaacgaagcctttgccgttattgatggtctatttgaaacc
cattacccagatttattggaccgctataatatatttggtggtgcattagcttatggtcat
ccctatggtgcctcagcagccattataatattgcacttaatgagggctttagagattaaa
aatggacactatggaatagctgctatagcagcagctggtggccaagggtttgctgtttta
ctaaaatatcataaggagtttagtcatgctgacaaagctagaatattgggcaaagcaatg
cccaaataa

DBGET integrated database retrieval system