KEGG   Streptococcus pyogenes MGAS2096 (serotype M12): MGAS2096_Spy0705Help
Entry
MGAS2096_Spy0705  CDS       T00357                                 

Definition
(GenBank) Ribosomal large subunit pseudouridine synthase D
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
spj  Streptococcus pyogenes MGAS2096 (serotype M12)
Brite
KEGG Orthology (KO) [BR:spj00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:spj03009]
    MGAS2096_Spy0705
Enzymes [BR:spj01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     MGAS2096_Spy0705
Ribosome biogenesis [BR:spj03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    MGAS2096_Spy0705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: ABF35757
Position
679276..679947
Genome map
AA seq 223 aa AA seqDB search
MDIIYEDDALAIINKPQGMVVHPSAGHPSGTMVNALMYHIKDLSSINGVVRPGIVHRIDK
DTSGLLMVAKTDAAHQALAEELKAKKSLRKYLAIVHGNLPNDRGMIEAPIGRSEKDRKKQ
AVTAKGKEAVTRFTVLERFGDYSLVELQLETGRTHQIRVHMAYIGHPVAGDPLYGPRKTL
SGHGQFLHAKTLGLTHPMTGKEMIFTVEAPEIFQKVLKLLRKK
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
ttggacattatctatgaagatgatgctctcgccattattaacaagccacagggaatggtg
gttcacccttcggcaggacacccttcaggaacaatggttaatgccttgatgtatcatatc
aaggatttgtcctcaatcaatggtgtggttcgtccaggaattgttcatcggattgataag
gacacctcaggtctcttaatggtagctaaaacagatgcagctcatcaagccttggcagaa
gaattaaaggctaaaaaatctctcagaaaatacctcgccattgtccatggaaacctaccg
aatgatcgcgggatgattgaagctcctataggtcgtagcgaaaaggaccgtaaaaaacag
gctgttacagcaaaaggcaaagaagcagtgacacgttttacagtgctagaacgttttggc
gattacagtctagtggaattacaactggaaactggtcgaacgcaccaaattcgtgttcat
atggcctatattggtcatcctgttgctggggaccctttatatggaccacgtaagacacta
tcaggtcatggccaatttcttcatgcaaaaacattgggattaacgcatcctatgacagga
aaagaaatgatatttactgttgaagctcccgaaatttttcaaaaggtgttaaagctgcta
agaaaaaaataa

DBGET integrated database retrieval system