KEGG   Streptococcus pyogenes MGAS2096 (serotype M12): MGAS2096_Spy0967Help
Entry
MGAS2096_Spy0967  CDS       T00357                                 

Definition
(GenBank) Oxaloacetate decarboxylase alpha chain
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
spj  Streptococcus pyogenes MGAS2096 (serotype M12)
Pathway
spj00620  Pyruvate metabolism
spj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MGAS2096_Spy0967
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:spj02000]
    MGAS2096_Spy0967
Enzymes [BR:spj01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     MGAS2096_Spy0967
Transporters [BR:spj02000]
 Other transporters
  Primary active transporters [TC:3]
   MGAS2096_Spy0967
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like
Motif
Other DBs
NCBI-ProteinID: ABF36019
Position
927694..927966
Genome map
AA seq 90 aa AA seqDB search
MIQFGGFSMQQQVAITETVLRDGHQSLMATRLSIEDMLPVLTILDKIGYYSLECWGGATF
DACIRFLNEDPWERLRTLKKGLPNTRLQMY
NT seq 273 nt NT seq  +upstreamnt  +downstreamnt
ttgattcagtttggaggttttagcatgcagcagcaagtcgcaataacagaaacagtttta
cgggacggtcatcaaagtttgatggcaacgcgtttatctattgaggatatgcttcctgtc
cttaccatcttagacaagattggttattattccctagagtgttggggaggagcaaccttt
gatgcctgtattcgttttttgaacgaagacccttgggaaagactgcgcacgttaaaaaaa
ggcttacctaatacccgtttacaaatgtattaa

DBGET integrated database retrieval system