KEGG   Streptococcus pyogenes MGAS2096 (serotype M12): MGAS2096_Spy1236Help
Entry
MGAS2096_Spy1236  CDS       T00357                                 

Gene name
gpmA
Definition
(GenBank) Phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
spj  Streptococcus pyogenes MGAS2096 (serotype M12)
Pathway
spj00010  Glycolysis / Gluconeogenesis
spj00260  Glycine, serine and threonine metabolism
spj00680  Methane metabolism
spj01100  Metabolic pathways
spj01110  Biosynthesis of secondary metabolites
spj01120  Microbial metabolism in diverse environments
spj01130  Biosynthesis of antibiotics
spj01200  Carbon metabolism
spj01230  Biosynthesis of amino acids
Module
spj_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
spj_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:spj00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MGAS2096_Spy1236 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    MGAS2096_Spy1236 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MGAS2096_Spy1236 (gpmA)
Enzymes [BR:spj01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     MGAS2096_Spy1236 (gpmA)
Membrane trafficking [BR:spj04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    MGAS2096_Spy1236 (gpmA)
Exosome [BR:spj04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   MGAS2096_Spy1236 (gpmA)
  Exosomal proteins of melanoma cells
   MGAS2096_Spy1236 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ABF36288
UniProt: Q1JAX0
Position
complement(1192906..1193601)
Genome map
AA seq 231 aa AA seqDB search
MVKLVFARHGESEWNKANLFTGWADVDLSEKGTQQAIDAGKLIKEAGIEFDLAFTSVLTR
AIKTTNLALENAGQLWVPTEKSWRLNERHYGALTGKNKAEAAEQFGDEQVHIWRRSYDVL
PPAMAKDDEYSAHKDRRYADLDPALIPDAENLKVTLERAMPYWEEKIAPALLDGKNVFVG
AHGNSIRALVKHIKGLSDDEIMDVEIPNFPPLVFELDEKLNIVKEYYLGGE
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaattggttttcgctcgccacggtgagtcagaatggaacaaagctaacctcttc
actggttgggcagatgttgatctttcagaaaaagggacacaacaagcgattgatgcaggt
aaattgatcaaagaagcaggtattgaatttgaccttgctttcacttcagtattgacacgt
gctatcaaaacaactaaccttgcccttgaaaatgcaggtcaattgtgggttccaactgaa
aaatcatggcgcttgaacgagcgtcactatggtgctttgactggcaaaaacaaagctgaa
gctgcagaacaatttggtgatgaacaagttcatatctggcgtcgttcatacgacgtgttg
ccgccagctatggctaaagatgatgagtattcagcacacaaagaccgtcgttatgctgat
cttgacccagcccttattccagatgctgaaaacttaaaagtaactcttgaacgcgcaatg
ccttactgggaagaaaaaattgctccagctcttcttgacggtaaaaacgtctttgttggt
gcacatggtaactcaatccgcgctcttgtgaaacacattaaaggtctttcagatgacgaa
atcatggatgtggaaattccaaacttcccaccacttgtttttgaattagatgaaaaactt
aacattgttaaagaatactaccttggtggtgaataa

DBGET integrated database retrieval system