KEGG   Streptococcus pyogenes MGAS2096 (serotype M12): MGAS2096_Spy1365Help
Entry
MGAS2096_Spy1365  CDS       T00357                                 

Gene name
atoB
Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
spj  Streptococcus pyogenes MGAS2096 (serotype M12)
Pathway
spj00071  Fatty acid degradation
spj00072  Synthesis and degradation of ketone bodies
spj00280  Valine, leucine and isoleucine degradation
spj00310  Lysine degradation
spj00362  Benzoate degradation
spj00380  Tryptophan metabolism
spj00620  Pyruvate metabolism
spj00630  Glyoxylate and dicarboxylate metabolism
spj00640  Propanoate metabolism
spj00650  Butanoate metabolism
spj00900  Terpenoid backbone biosynthesis
spj01100  Metabolic pathways
spj01110  Biosynthesis of secondary metabolites
spj01120  Microbial metabolism in diverse environments
spj01130  Biosynthesis of antibiotics
spj01200  Carbon metabolism
spj01212  Fatty acid metabolism
spj02020  Two-component system
Brite
KEGG Orthology (KO) [BR:spj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MGAS2096_Spy1365 (atoB)
   00630 Glyoxylate and dicarboxylate metabolism
    MGAS2096_Spy1365 (atoB)
   00640 Propanoate metabolism
    MGAS2096_Spy1365 (atoB)
   00650 Butanoate metabolism
    MGAS2096_Spy1365 (atoB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MGAS2096_Spy1365 (atoB)
   00072 Synthesis and degradation of ketone bodies
    MGAS2096_Spy1365 (atoB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MGAS2096_Spy1365 (atoB)
   00310 Lysine degradation
    MGAS2096_Spy1365 (atoB)
   00380 Tryptophan metabolism
    MGAS2096_Spy1365 (atoB)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MGAS2096_Spy1365 (atoB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MGAS2096_Spy1365 (atoB)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    MGAS2096_Spy1365 (atoB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:spj04147]
    MGAS2096_Spy1365 (atoB)
Enzymes [BR:spj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MGAS2096_Spy1365 (atoB)
Exosome [BR:spj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MGAS2096_Spy1365 (atoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C FAE1_CUT1_RppA
Motif
Other DBs
NCBI-ProteinID: ABF36417
Position
1330446..1331633
Genome map
AA seq 395 aa AA seqDB search
MKNIVIVEALRTPIGAFGGSFKSVSAVELGTTVLKKILDKTQVKPEMVDEVILGNVLHAG
LGQNVARQVAVHSGIPEDKTAFTLDMVCGSGLKAIQLAAQSIMLGDADIVIAGGVENMSQ
AAYVSTQHRFGQRLGNSQLIDTLVHDGLTDAFNNYHMGITAENVAQKYGISREEQDQFAL
ESQEKAARALENHRFADEIVPVSVPQRRKDPLIVTTDEYPKVDTSLEKLQQLRPAFLPKE
GTVTAGNASGINDGAALLMLMTEEKALELGLTPLVTIESYASAGVAPELMGTGPIPATQK
ALKKAGLTISDLDLVESNEAFAAQSLAVLKDLKLNPEIVNVNGGAIALGHPIGASGARIL
VTLIHEMKKRQVTRGLATLCIGGGQGTAVIVKNNT
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatatagttatcgttgaagctttacgaactcctatcggagcttttggaggctcc
tttaaaagtgtctctgctgttgaacttggaacaactgtactgaaaaaaatccttgataaa
acgcaagtaaagcctgaaatggttgatgaagtcatcctaggaaacgtccttcatgcaggc
ctaggacaaaatgtggcaagacaagttgcagtccactcaggaattcctgaagataaaaca
gctttcacattagacatggtttgcggttctggacttaaagcaatccaattagctgcgcaa
agcatcatgcttggtgacgctgatatcgttattgctggtggtgtcgaaaacatgtcacaa
gcagcttatgtctcaactcagcaccgctttggtcaacgtcttggtaatagtcaattgatt
gatactcttgttcatgatggcttaacagatgcttttaacaattaccacatgggtattact
gctgaaaacgttgctcagaaatatggcatctcaagagaagagcaagatcaatttgcttta
gaaagccaagaaaaagctgctagggcattagaaaatcatcgttttgctgacgaaattgtc
cctgtctctgtgcctcaacgacgcaaagatcctttaattgttacgacggatgaataccca
aaagttgacacaagccttgaaaaattacagcaattacgtcctgctttcctccctaaagaa
ggaaccgttactgctgggaatgcctcaggaataaacgatggtgcagccttattgatgtta
atgactgaagaaaaagctcttgaattagggttaacacctttagtcactattgaaagctat
gctagtgcaggtgttgcacctgaactgatgggaactggaccaattcctgccactcaaaaa
gcccttaagaaagctggattaacaatttctgatttggacttagtggagtccaatgaagca
tttgcagcacagtccttggcggttttaaaagatttaaagttaaacccagaaatcgtgaat
gttaatggaggagccatcgctttaggtcatcctattggtgccagtggcgctcgcattcta
gtcacattaatccacgaaatgaaaaaacgccaagtaaccagaggactagcaacactttgc
attggtggaggacaaggaactgctgttatcgtgaaaaacaatacttag

DBGET integrated database retrieval system