KEGG   Streptococcus pyogenes MGAS2096 (serotype M12): MGAS2096_Spy1435Help
Entry
MGAS2096_Spy1435  CDS       T00357                                 

Gene name
infB
Definition
(GenBank) Bacterial Protein Translation Initiation Factor 2 (IF-2)
  KO
K02519  translation initiation factor IF-2
Organism
spj  Streptococcus pyogenes MGAS2096 (serotype M12)
Brite
KEGG Orthology (KO) [BR:spj00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:spj03012]
    MGAS2096_Spy1435 (infB)
   03029 Mitochondrial biogenesis [BR:spj03029]
    MGAS2096_Spy1435 (infB)
Translation factors [BR:spj03012]
 Eukaryotic type
  Initiation factors
   MTIFs
    MGAS2096_Spy1435 (infB)
 Prokaryotic type
   MGAS2096_Spy1435 (infB)
Mitochondrial biogenesis [BR:spj03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    MGAS2096_Spy1435 (infB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IF-2 GTP_EFTU IF2_N MMR_HSR1 Ras SRPRB Arf FeoB_N HTH_38 MMR_HSR1_Xtn PduV-EutP
Motif
Other DBs
NCBI-ProteinID: ABF36487
UniProt: Q1JAC1
Position
complement(1398085..1400946)
Genome map
AA seq 953 aa AA seqDB search
MSKKRLHEIAKEIGKSSKEVVEHAKYLGLDVKSHASSVEEADAKKIISSFSKASKPDVTA
SQTVKPKEVAQPSVTVVKETGSEHVEKTQVSKPKSRNFKAEREARAKEQAARKQANGSSH
RSQERRGGYRQPNNHQTNEQGDKRITHRSQGDTNDKRIERKASNVSPRHDNHQLVGDRNR
SFAKENHKNGRFTNQKKQGRQEPQSKSPKIDFKARAAALKAEQNAEYSRQSETRFRAQQE
AKRLAELARQEAKEAALKAQAEEMSHREAALKSIEEAETKLKSSNISAKSTADNRRKKQA
RPEKNRELTHHSQEGQKKNKKSWNSQNQVRNQKNSNWNKNKKTKKGKNVKNTNTAPKPVT
ERKFHELPKEFEYTEGMTVAEIAKRIKREPAEIVKKLFMMGVMATQNQSLDGDTIELLMV
DYGIEAKAKVEVDDADIERFFEDENYLNPENIVERAPVVTIMGHVDHGKTTLLDTLRNSR
VATGEAGGITQHIGAYQIEEAGKKITFLDTPGHAAFTSMRARGASVTDITILIVAADDGV
MPQTIEAINHSKAAGVPIIVAINKIDKPGANPERVIAELAEYGIISTAWGGECEFVEISA
KFNKNIDELLETVLLVAEVEELKADPTVRAIGTVIEARLDKGKGAIATLLVQQGTLHVQD
PIVVGNTFGRVRAMVNDLGRRVKSAEPSTPVSITGLNETPMAGDHFAVYADEKAARAAGE
ERSKRALLKQRQNTQRVSLDNLFDTLKAGEIKTVNVIIKADVQGSVEALAASLVKIEVEG
VRVNVVHSAVGAINESDVTLAEASNAVIIGFNVRPTPQARQQADTDDVEIRLHSIIYKVI
EEVEEAMKGKLDPVYQEKILGEAIIRETFKVSKVGTIGGFMVINGKVTRDSSVRVIRDSV
VIFDGKLASLKHYKDDVKEVGNAQEGGLMIENFNDLKVDDTIEAYIMEEIVRK
NT seq 2862 nt NT seq  +upstreamnt  +downstreamnt
ttgtcaaagaaaagattacatgaaattgccaaggaaattggtaaaagtagtaaagaggtg
gttgaacacgctaaatacttaggattagatgtgaaaagccatgcatcaagtgttgaagaa
gcggatgcgaaaaagattatttcaagtttttcaaaggcttctaaacctgatgtgacagct
tctcaaacagtcaaacccaaagaagttgctcaaccctctgtaacagtggtcaaagaaaca
ggttctgagcatgtagagaaaacacaggtctctaagccaaagagtcgtaattttaaagct
gaaagagaggctcgtgcaaaggaacaggctgctcgaaaacaagcaaatggctcttctcat
cgttctcaagaacgtcgaggaggttatcgccagcccaataatcatcaaactaacgaacaa
ggagataagaggattactcatcgttctcaaggtgatacaaacgataagcgtattgagcga
aaagcatcgaatgtatcacctagacatgataatcatcagctagttggtgatcgtaaccgt
tcctttgctaaggagaatcacaagaatggtcgattcacaaaccaaaaaaagcaaggacga
caagagccccaatcgaaaagtcctaaaattgatttcaaagctcgtgctgctgccttaaaa
gctgaacaaaatgctgaatactcacgccaaagtgaaacacgttttcgtgcacagcaagaa
gctaagcgtttagctgagttggcaagacaagaagctaaagaagcggctctaaaagcacaa
gctgaggagatgagccatcgtgaagcagcactgaaatctattgaagaagcagaaactaaa
ttaaagtcatcaaatattagtgctaaatctactgctgataatcgccgtaaaaaacaagca
cgtcctgaaaagaatcgtgagttaactcatcattcacaagaaggacaaaagaaaaataag
aagagttggaatagtcaaaaccaagtgagaaatcaaaaaaatagtaactggaataaaaat
aaaaagaccaaaaaaggcaaaaatgttaagaataccaacaccgctccaaaaccagtaacc
gagcgtaaattccatgaattgccaaaagaatttgaatatactgaaggcatgacagttgcc
gaaatcgcaaaacgtatcaaacgcgaacccgctgaaattgttaaaaagctgtttatgatg
ggtgttatggcaactcaaaaccagtctttagatggggatactatcgaattattgatggta
gattatggtattgaggctaaggctaaggtagaagtagatgatgctgatatcgagcgcttc
tttgaggatgaaaattacctcaatcctgaaaatattgtagaacgcgcacctgttgtaact
atcatgggacacgtagaccacggtaagacaactttgcttgatactttgcgtaactcacgt
gtggcaacaggagaagctggaggaattactcagcatattggtgcttaccagattgaagaa
gctggcaagaaaattaccttcttggatactcccggacacgcggcctttacaagcatgcgc
gcacgtggagcttccgttaccgatatcaccattttgattgttgcagctgatgatggtgtt
atgccacaaacgattgaagcgatcaatcactcaaaagctgctggtgttccaattattgtt
gctatcaacaaaattgataaaccaggtgctaatccagaacgtgttatcgcagaattggca
gaatatggtatcatctcaactgcttggggcggagagtgcgaatttgtagagatatctgct
aaatttaataaaaatattgatgaactattagaaacagtccttttggttgctgaagtggaa
gaattgaaagctgatccgacggttcgtgctattggtactgtaattgaagcacgcttagat
aaaggtaaaggtgctatcgctacgcttcttgtccaacaaggaactcttcatgttcaagac
ccaatcgttgttggtaatacctttggtcgtgtccgtgccatggtaaatgaccttgggcgt
cgtgttaaatctgcggagccatcaacaccagtttccattactggtttgaacgaaacacca
atggctggtgatcactttgctgtttacgctgatgaaaaagctgcgcgtgcagctggtgag
gagcgatcaaaacgtgccctcctcaaacaacgtcaaaatacacagcgtgttagccttgat
aatctctttgatacccttaaagcaggagaaatcaagactgttaatgtcatcatcaaagca
gacgttcaaggttctgttgaagcccttgcagcatctcttgtaaagattgaagtggaaggt
gtccgtgtcaatgtcgttcactctgctgtaggtgctatcaatgagtctgatgtgaccctt
gctgaagcatcaaatgctgttattatcggtttcaacgttcgccctaccccacaagctcgt
caacaagcagatacggatgatgtggaaattcgtcttcatagtattatctataaagtcatt
gaagaagtagaagaagccatgaaagggaaacttgaccctgtttaccaagaaaaaattctt
ggtgaagccattattcgtgaaaccttcaaagtttctaaagtgggaacaattggtggcttt
atggtaatcaacggtaaggtgacacgtgattcgagtgttcgtgttatccgtgatagtgtc
gttatttttgatggtaaactggccagcttgaaacattacaaagatgacgttaaagaagtc
ggtaatgctcaagaaggtgggttgatgattgaaaactttaacgatcttaaagttgacgat
actattgaagcctatattatggaagaaattgtgagaaaatag

DBGET integrated database retrieval system