KEGG   Streptococcus pyogenes MGAS2096 (serotype M12): MGAS2096_Spy1528Help
Entry
MGAS2096_Spy1528  CDS       T00357                                 

Gene name
hrcA
Definition
(GenBank) Heat-inducible transcription repressor hrcA
  KO
K03705  heat-inducible transcriptional repressor
Organism
spj  Streptococcus pyogenes MGAS2096 (serotype M12)
Brite
KEGG Orthology (KO) [BR:spj00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:spj03000]
    MGAS2096_Spy1528 (hrcA)
Transcription factors [BR:spj03000]
 Prokaryotic type
  Other transcription factors
   Others
    MGAS2096_Spy1528 (hrcA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HrcA HrcA_DNA-bdg HTH_DeoR HTH_11 LexA_DNA_bind HTH_20 GST_C_3 Ribosomal_S19e
Motif
Other DBs
NCBI-ProteinID: ABF36580
UniProt: Q1JA81
Position
complement(1474026..1475060)
Genome map
AA seq 344 aa AA seqDB search
MITQRQNDILNLIVELFTQTHEPVGSKALQRTIDSSSATIRNDMAKLEKLGLLEKAHTSS
GRMPSPAGFKYFVEHSLRLDSIDEQDIYHVIKAFDFEAFKLEDMLQKASHILAEMTGYTS
VILDVEPARQRLTGFDVVQLSNHDALAVMTLDESKPVTVQFAIPRNFLTRDLIAFKAIVE
ERLLDNSVIDIHYKLRTEIPQIVQKYFVTTDNVLQLFDYVFSELFLETVFVAGKVNSLTY
SDLSTYQFLDNEQQVAISLRQSLKEGEMASVQVADSQEAALADVSVLTHKFLIPYRGFGL
LSLIGPIDMDYRRSVSLVNIIGKVLAAKLGDYYRYLNSNHYEVH
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
gtgattacacaacgtcaaaatgatattttgaatttaatcgttgagctatttacacaaact
catgaaccagtagggtctaaagctttacagagaacgattgattctagtagcgccactatt
cgtaatgatatggcaaaactagagaagttgggattgttggaaaaagcgcacacttctagt
ggacggatgccaagtccagctggttttaagtattttgtagagcactccctcaggctagat
agtattgatgagcaagatatttatcatgtcataaaagcttttgattttgaagcattcaaa
ttagaagacatgcttcaaaaagctagtcacattttagcggagatgacgggctatacatcc
gttattttagatgtggagccagctcgtcaacgtttaacagggtttgatgttgttcagctt
agcaaccatgatgctctagcagtcatgactttagatgaatctaagccagtgacagtgcag
tttgctattccaagaaactttttgacacgtgacttgatagcatttaaagctatcgtagag
gagcgcttgctggataatagtgtcatagatattcattataagttgaggacagaaattcct
cagatcgttcaaaagtattttgtgactacggataatgttttacaactatttgattatgtt
ttttcagagctgtttttggaaacggtatttgttgctggcaaggtaaattctttaacgtat
tcagatctatcaacgtatcagtttttggataatgaacagcaagtagcaatttctttgagg
caaagtctgaaagaaggtgagatggcttctgtccaagtggcagatagtcaagaagccgca
cttgcagatgtgtcagttttaactcacaaatttttgattccttaccgtgggtttggactc
ctgagtttaattggtcctattgatatggattatcgtaggtctgttagtttggtaaacatt
attggaaaggtattggctgctaaattaggtgattattatcgatacctaaattctaaccat
tatgaagttcactga

DBGET integrated database retrieval system