KEGG   Streptococcus pyogenes MGAS2096 (serotype M12): MGAS2096_Spy1814
Entry
MGAS2096_Spy1814  CDS       T00357                                 

Definition
(GenBank) Protein Translation Elongation Factor Ts (EF-Ts)
  KO
K02357  elongation factor Ts
Organism
spj  Streptococcus pyogenes MGAS2096 (serotype M12)
Brite
KEGG Orthology (KO) [BR:spj00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:spj03012]
    MGAS2096_Spy1814
   03029 Mitochondrial biogenesis [BR:spj03029]
    MGAS2096_Spy1814
Translation factors [BR:spj03012]
 Eukaryotic type
  Elongation factors
   MGAS2096_Spy1814
 Prokaryotic type
   MGAS2096_Spy1814
Mitochondrial biogenesis [BR:spj03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    MGAS2096_Spy1814
SSDB
Motif
Pfam: EF_TS DUF4101
Other DBs
NCBI-ProteinID: ABF36866
UniProt: Q1J9E5
Position
1770094..1771230
AA seq 378 aa
MSLTIENQTGQKANRSVSFFETKTNIIWRILHMAEITAKLVKELREKSGAGVMDAKKALV
ETDGDMDKAVELLREKGMAKAAKKADRVAAEGLTGVYVHGNVAAVVEVNAETDFVAKNAQ
FVELVNATAKVIAEGKPANNDEALALVMPSGETLAEAYVNATATIGEKISFRRFALIEKT
DEQHFGAYQHNGGRIGVISVVEGGDDALAKQVSMHIAAMKPTVLSYTELDAQFIKDELAQ
LNHAIELDNESRAMVDKPALPFLKYGSKAQLSDDVITAAEADIKAELAAEGKPEKIWDKI
IPGKMDRFMLDNTKVDQAYTLLAQVYIMDDSKTVEAYLDSVNAKAIAFARFEVGEGIEKK
ANDFESEVAATMAAALNN
NT seq 1137 nt   +upstreamnt  +downstreamnt
ttgtctttaacaatcgaaaaccaaacggggcagaaagcaaaccgctctgtctcgtttttt
gaaaccaaaacaaatatcatttggaggatactacacatggcagaaattacagctaagctt
gtaaaagaattacgtgaaaaatctggtgctggcgttatggacgctaaaaaagcacttgtt
gaaacagatggtgacatggacaaagccgttgaacttcttcgtgaaaaaggaatggctaaa
gcagctaaaaaagctgaccgtgttgccgctgaaggtttaacaggcgtttacgttcatggt
aacgttgctgctgttgttgaagttaacgctgaaacagactttgttgctaaaaatgctcaa
ttcgttgaattggtaaacgcaactgctaaagttatcgctgaaggcaaaccagctaacaac
gatgaagcacttgcacttgttatgccttcaggtgaaactcttgctgaagcttacgttaat
gcaactgctaccatcggagaaaaaatctcattccgtcgttttgctttgattgaaaaaaca
gatgagcaacacttcggtgcttaccaacataatggtggccgtatcggggttatctcagtt
gtcgaaggcggcgacgatgctcttgctaaacaagtatcaatgcatatcgctgcaatgaaa
ccaactgttctttcatacactgagcttgatgcacaattcatcaaagatgaacttgctcaa
ttgaaccacgctatcgaacttgacaacgaatcgcgtgcaatggttgacaaaccagcactt
ccattcttgaaatacggttcaaaagctcaattatcagacgacgtgattactgctgctgaa
gcagacatcaaagctgaacttgctgctgaaggcaaaccagaaaagatctgggacaaaatc
atcccaggtaaaatggaccgtttcatgcttgacaacactaaagttgaccaagcttacact
cttcttgcacaagtttacatcatggacgacagcaaaactgttgaagcttaccttgactca
gtaaacgctaaagcgattgcttttgcacgttttgaagttggtgaaggtatcgagaaaaaa
gctaacgactttgaatcagaagttgcagctactatggctgctgcccttaacaactaa

DBGET integrated database retrieval system