KEGG   Streptococcus pyogenes MGAS2096 (serotype M12): MGAS2096_Spy1867
Entry
MGAS2096_Spy1867  CDS       T00357                                 

Gene name
rplI
Definition
(GenBank) LSU ribosomal protein L9P
  KO
K02939  large subunit ribosomal protein L9
Organism
spj  Streptococcus pyogenes MGAS2096 (serotype M12)
Pathway
spj03010  Ribosome
Brite
KEGG Orthology (KO) [BR:spj00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    MGAS2096_Spy1867 (rplI)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:spj03011]
    MGAS2096_Spy1867 (rplI)
Ribosome [BR:spj03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    MGAS2096_Spy1867 (rplI)
  Bacteria
    MGAS2096_Spy1867 (rplI)
SSDB
Motif
Pfam: Ribosomal_L9_C Ribosomal_L9_N PP-binding
Other DBs
NCBI-ProteinID: ABF36919
UniProt: Q1J992
Position
complement(1823433..1823885)
AA seq 150 aa
MKVIFLADVKGKGKKGEIKEVPTGYAQNFLIKKNLAKEATSQSIGELKGKQKAEEKAQAE
ILAEAQAVKAVLDEDKTRVQFQEKVGPDGRTFGSITAKKISEELQKQFGVKVDKRHIVLD
HPIRAIGLIEVPVKLHKEVTAEIKLAITEA
NT seq 453 nt   +upstreamnt  +downstreamnt
atgaaagttatttttttagcagatgtaaaaggaaaaggtaaaaaaggagaaatcaaagag
gtcccaacaggctatgctcaaaatttccttattaagaaaaatttagctaaagaagcaact
agtcaaagcatcggtgaattaaaaggaaaacaaaaagctgaagaaaaagctcaagctgaa
atattagcagaagctcaagctgtcaaggctgttttggatgaggacaaaacacgtgttcaa
tttcaagaaaaagttggcccagatggacgtacatttggttccatcacagctaaaaagatt
tcagaagaattgcaaaagcaatttggtgtgaaagttgataaacgtcatattgttttagat
catcctatccgcgccattggtctaattgaagttcctgtgaaattacataaggaagtaaca
gctgagattaaattggctatcacagaagcataa

DBGET integrated database retrieval system